Anti-RPA70 Polyclonal Antibody – Cat# MBS177992

Western blot analysis of RPA70 expression in HELA whole cell lysates (lane 1), JURKAT whole cell lysates (lane 2) and COLO320 whole cell lysates (lane 3). RPA70 at 70KD was detected using rabbit anti- RPA70 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

RPA70 Antibody – Polyclonal

Name: RPA70 Antibody; Polyclonal; Human-Reactive; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS177992
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177992

Description: Rabbit IgG polyclonal antibody for Replication protein A 70 kDa DNA-binding subunit(RPA1) detection. Tested with WB in Human.Background: Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene.… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RPA70, Polyclonal Antibody

Full Product Name

Anti-RPA70 Antibody

Product Gene Name

anti-RPA70 antibody

Product Synonym Names

Replication protein A 70 kDa DNA-binding subunit; Dmrpa1; Drosophila Replication Protein A; DRPA; HSSB; Human single stranded DNA binding protein; MST075; MSTP075; p70; REPA1; Replication factor A; Replication factor A protein 1; Replication protein A 70 kDa DNA-binding subunit; Replication protein A 70kDa DNA binding subunit; Replication protein A1 70kDa; Replication protein A1; RF A; RF-A protein 1; RFA; RFA1_HUMAN; RP A; RP-A p70; RPA 70; RPA; rpa1; Single stranded binding protein 70; Single-stranded DNA-binding protein; replication protein A1

Clonality

Polyclonal

Species Reactivity

Human

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

68,138 Da

OMIM

179835

3D Structure

ModBase 3D Structure for P27694

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-RPA70 antibody

Western Blot (WB)

Application Notes for anti-RPA70 antibody

Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-RPA70 antibody

1. Erdile, L. F., Heyer, W.-D., Kolodner, R., Kelly, T. J. Characterization of a cDNA encoding the 70-kDa single-stranded DNA-binding subunit of human replication protein A and the role of the protein in DNA replication. J. Biol. Chem. 266: 12090-12098, 1991. Note: Erratum: J. Biol. Chem. 268: 2268 only, 1993. 2. Haring, S. J., Mason, A. C., Binz, S. K., Wold, M. S. Cellular functions of human RPA1: multiple roles of domains in replication, repair, and checkpoints. J. Biol. Chem. 283: 19095-19111, 2008.

Other Notes

Small volumes of anti-RPA70 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RPA70 purchase

MBS177992 is an antibody targeting RPA70. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for RPA70. It may not necessarily be applicable to this product.

NCBI GI #

4506583

NCBI GeneID

6117

NCBI Accession #

NP_002936.1

UniProt Primary Accession #

P27694

UniProt Secondary Accession #

Q59ES9; A8K0Y9

UniProt Related Accession #

P27694

GenBank Nucleotide #

NM_002945.3

NCBI Official Full Name

replication protein A 70 kDa DNA-binding subunit

NCBI Official Synonym Full Names

replication protein A1

NCBI Official Symbol

RPA1

NCBI Official Synonym Symbols

HSSB; RF-A; RP-A; REPA1; RPA70; MST075

UniProt Protein Name

Replication protein A 70 kDa DNA-binding subunit

UniProt Synonym Protein Names

Replication factor A protein 1; RF-A protein 1

UniProt Gene Name

RPA1

UniProt Synonym Gene Names

REPA1; RPA70; RP-A p70; RF-A protein 1

UniProt Entry Name

RFA1_HUMAN

NCBI Protein Information

replication protein A 70 kDa DNA-binding subunit

UniProt Comments for RPA70

RPA1: Plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. Binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. Heterotrimer composed of RPA1, RPA2 and RPA3 (canonical replication protein A complex). Component of the alternative replication protein A complex (aRPA) composed of RPA1, RPA3 and RPA4. The DNA-binding activity may reside exclusively on the RPA1 subunit. Interacts with RIPK1 and XPA. Interacts with RPA4. Interacts with the polymerase alpha subunit POLA1/p180; this interaction stabilizes the replicative complex and reduces the misincorporation rate of DNA polymerase alpha by acting as a fidelity clamp. Interact with RAD51 and SENP6 to regulate DNA repair. Interacts with HELB; this interaction promotes HELB recruitement to chromatin following DNA damage. Belongs to the replication factor A protein 1 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: DNA replication factor A complex; nuclear chromosome, telomeric region; nucleoplasm; nucleus; PML body

Molecular Function: damaged DNA binding; metal ion binding; protein binding; single-stranded DNA binding

Biological Process: base-excision repair; bypass DNA synthesis; DNA damage response, detection of DNA damage; DNA recombination; DNA repair; DNA replication; DNA-dependent DNA replication; double-strand break repair via homologous recombination; error-prone postreplication DNA repair; G1/S transition of mitotic cell cycle; mismatch repair; nucleotide-excision repair; nucleotide-excision repair, DNA gap filling; nucleotide-excision repair, DNA incision; nucleotide-excision repair, DNA incision, 3'-to lesion; nucleotide-excision repair, DNA incision, 5'-to lesion; nucleotide-excision repair, preincision complex assembly; nucleotide-excision repair, preincision complex stabilization; protein sumoylation; telomere maintenance; telomere maintenance via recombination; transcription-coupled nucleotide-excision repair

Research Articles on RPA70

1. BRG1-RAD52 complex mediates the replacement of RPA with RAD51 on single-stranded DNA (ssDNA) to initiate DNA strand invasion. Loss of BRG1 results in a failure of RAD51 loading onto ssDNA, abnormal homologous recombination repair

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RPA70 antibody

Reference Product	PubMed Publications
PCNA antibody	>65 publications with RPA70 and PCNA
XPA antibody	>62 publications with RPA70 and XPA
RPA2 antibody	>61 publications with RPA70 and RPA2
ATR antibody	>51 publications with RPA70 and ATR
RAD51 antibody	>49 publications with RPA70 and RAD51
RPA3 antibody	>33 publications with RPA70 and RPA3
RAD52 antibody	>16 publications with RPA70 and RAD52
BLM antibody	>13 publications with RPA70 and BLM
DNA2 antibody	>5 publications with RPA70 and DNA2
RPA4 antibody	>5 publications with RPA70 and RPA4

Pathways associated with anti-RPA70 antibody

Products by Pathway	Pathway Diagram
Activation Of ATR In Response To Replication Stress Pathway antibodies	Activation Of ATR In Response To Replication Stress Pathway Diagram
Activation Of The Pre-replicative Complex Pathway antibodies	Activation Of The Pre-replicative Complex Pathway Diagram
Base Excision Repair Pathway antibodies	Base Excision Repair Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
Cell Cycle Checkpoints Pathway antibodies	Cell Cycle Checkpoints Pathway Diagram
Cell Cycle, Mitotic Pathway antibodies	Cell Cycle, Mitotic Pathway Diagram
Cellular Response To Heat Stress Pathway antibodies	Cellular Response To Heat Stress Pathway Diagram
Cellular Responses To Stress Pathway antibodies	Cellular Responses To Stress Pathway Diagram
Chromosome Maintenance Pathway antibodies	Chromosome Maintenance Pathway Diagram
DNA Damage Bypass Pathway antibodies	DNA Damage Bypass Pathway Diagram

Diseases associated with anti-RPA70 antibody

Disease Name	Pubmed Publications
Carcinoma Antibodies	>24 publications with RPA70 and Carcinoma
Precancerous Conditions Antibodies	>23 publications with RPA70 and Precancerous Conditions
Breast Neoplasms Antibodies	>13 publications with RPA70 and Breast Neoplasms
Vascular Diseases Antibodies	>9 publications with RPA70 and Vascular Diseases
Cardiovascular Diseases Antibodies	>9 publications with RPA70 and Cardiovascular Diseases
Abnormalities, Multiple Antibodies	>8 publications with RPA70 and Abnormalities, Multiple
Anemia Antibodies	>7 publications with RPA70 and Anemia
Adenocarcinoma Antibodies	>6 publications with RPA70 and Adenocarcinoma
Lung Neoplasms Antibodies	>5 publications with RPA70 and Lung Neoplasms
Ovarian Neoplasms Antibodies	>4 publications with RPA70 and Ovarian Neoplasms

Organs/Tissues associated with anti-RPA70 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>22 publications with RPA70 and Blood
Brain Antibodies	>11 publications with RPA70 and Brain
Skin Antibodies	>9 publications with RPA70 and Skin
Lung Antibodies	>8 publications with RPA70 and Lung
Liver Antibodies	>6 publications with RPA70 and Liver
Ovary Antibodies	>5 publications with RPA70 and Ovary
Lymph Node Antibodies	>5 publications with RPA70 and Lymph Node
Placenta Antibodies	>4 publications with RPA70 and Placenta
Lymph Antibodies	>4 publications with RPA70 and Lymph
Bone Antibodies	>4 publications with RPA70 and Bone