Anti-MCM8 Polyclonal Antibody – Cat# MBS178026

Anti- MCM8 Picoband antibody, MBS178026, Western blotting
All lanes: Anti MCM8 (MBS178026) at 0.5ug/ml
Lane 1: A549 Whole Cell Lysate at 40ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 94KD
Observed bind size: 94KD

MCM8 Antibody – Polyclonal

Name: MCM8 Antibody; Polyclonal; Human-Reactive; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178026
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178026

Description: Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.Background: DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MCM8, Polyclonal Antibody

Full Product Name

Anti-MCM8 Antibody

Product Gene Name

anti-MCM8 antibody

Product Synonym Names

DNA helicase MCM8; C20orf154; dJ967N21.5; DNA helicase MCM8; DNA replication licensing factor MCM8; MCM8; MCM8_HUMAN; MGC119522; MGC119523; MGC12866; MGC4816; Minichromosome maintenance 8; Minichromosome maintenance complex component 8; REC; minichromosome maintenance 8 homologous recombination repair factor

Clonality

Polyclonal

Species Reactivity

Human

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

97,932 Da

OMIM

608187

3D Structure

ModBase 3D Structure for Q9UJA3

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-MCM8 antibody

Western Blot (WB)

Application Notes for anti-MCM8 antibody

Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-MCM8 antibody

1. "Entrez Gene: MCM8 MCM8 minichromosome maintenance deficient 8 (S. cerevisiae)". 2. Gozuacik D, Chami M, Lagorce D, Faivre J, Murakami Y, Poch O, Biermann E, Knippers R, Brechot C, Paterlini-Brechot P (Jan 2003). "Identification and functional characterization of a new member of the human Mcm protein family: hMcm8". Nucleic Acids Res 31 (2): 570-9.

Other Notes

Small volumes of anti-MCM8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MCM8 purchase

MBS178026 is an antibody targeting MCM8. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for MCM8. It may not necessarily be applicable to this product.

NCBI GI #

528078336

NCBI GeneID

84515

NCBI Accession #

NP_001268449.1

UniProt Primary Accession #

Q9UJA3

UniProt Secondary Accession #

Q495R4; Q495R6; Q495R7; Q86US4; Q969I5; B2RBG7; D3DW08; E7EQU7

UniProt Related Accession #

Q9UJA3

GenBank Nucleotide #

NM_001281520.1

NCBI Official Full Name

DNA helicase MCM8 isoform 1

NCBI Official Synonym Full Names

minichromosome maintenance 8 homologous recombination repair factor

NCBI Official Symbol

MCM8

NCBI Official Synonym Symbols

POF10; C20orf154; dJ967N21.5

UniProt Protein Name

DNA helicase MCM8

UniProt Synonym Protein Names

Minichromosome maintenance 8

Protein Family

DNA helicase

UniProt Gene Name

MCM8

UniProt Synonym Gene Names

C20orf154

UniProt Entry Name

MCM8_HUMAN

NCBI Protein Information

DNA helicase MCM8

NCBI Summary for MCM8

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the mini-chromosome maintenance proteins is a key component of the pre-replication complex and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the mini-chromosome maintenance proteins. The encoded protein may interact with other mini-chromosome maintenance proteins and play a role in DNA replication. This gene may be associated with length of reproductive lifespan and menopause. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2013]

UniProt Comments for MCM8

MCM8: Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8- MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle. Belongs to the MCM family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 20p12.3

Cellular Component: nucleoplasm; nucleus

Molecular Function: ATP binding; DNA binding; helicase activity; protein binding

Biological Process: DNA replication; double-strand break repair via homologous recombination; female gamete generation; G1/S transition of mitotic cell cycle; male gamete generation; response to DNA damage stimulus

Disease: Premature Ovarian Failure 10

Research Articles on MCM8

1. MCM8, a component of the pre-replication complex, is crucial for gonadal development and maintenance in humans-both males and females. These

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MCM8 antibody

Products by Pathway	Pathway Diagram
Activation Of ATR In Response To Replication Stress Pathway antibodies	Activation Of ATR In Response To Replication Stress Pathway Diagram
Activation Of The Pre-replicative Complex Pathway antibodies	Activation Of The Pre-replicative Complex Pathway Diagram
Assembly Of The Pre-replicative Complex Pathway antibodies	Assembly Of The Pre-replicative Complex Pathway Diagram
CDC6 Association With The ORC:origin Complex Pathway antibodies	CDC6 Association With The ORC:origin Complex Pathway Diagram
CDT1 Association With The CDC6:ORC:origin Complex Pathway antibodies	CDT1 Association With The CDC6:ORC:origin Complex Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
Cell Cycle Checkpoints Pathway antibodies	Cell Cycle Checkpoints Pathway Diagram
Cell Cycle, Mitotic Pathway antibodies	Cell Cycle, Mitotic Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
DNA Replication Pathway antibodies	DNA Replication Pathway Diagram

Diseases associated with anti-MCM8 antibody

Disease Name	Pubmed Publications
Infertility, Female Antibodies	>2 publications with MCM8 and Infertility, Female
Lung Diseases Antibodies	>1 publications with MCM8 and Lung Diseases
Carcinoma Antibodies	>1 publications with MCM8 and Carcinoma
Adenocarcinoma Antibodies	>1 publications with MCM8 and Adenocarcinoma
Precancerous Conditions Antibodies	>1 publications with MCM8 and Precancerous Conditions
Heart Diseases Antibodies	>1 publications with MCM8 and Heart Diseases
Anemia Antibodies	>1 publications with MCM8 and Anemia
Hypertension Antibodies	>1 publications with MCM8 and Hypertension
Atherosclerosis Antibodies	>1 publications with MCM8 and Atherosclerosis
Colonic Neoplasms Antibodies	>1 publications with MCM8 and Colonic Neoplasms

Organs/Tissues associated with anti-MCM8 antibody

Organ/Tissue Name	Pubmed Publications
Ovary Antibodies	>5 publications with MCM8 and Ovary
Bone Antibodies	>3 publications with MCM8 and Bone
Heart Antibodies	>3 publications with MCM8 and Heart
Lung Antibodies	>3 publications with MCM8 and Lung
Liver Antibodies	>1 publications with MCM8 and Liver
Placenta Antibodies	>1 publications with MCM8 and Placenta
Bone Marrow Antibodies	>1 publications with MCM8 and Bone Marrow