• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

c-REL Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178033

Description: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
c-Rel, Polyclonal Antibody
Full Product Name
Anti-c-Rel Antibody
Product Gene Name
anti-c-Rel antibody
Product Synonym Names
Proto-oncogene c-Rel; Avian reticuloendotheliosis; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL; Oncogene REL avian reticuloendotheliosis; Proto-oncogene c-Rel; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog; V rel reticuloendotheliosis viral oncogene homolog (avian); v-rel avian reticuloendotheliosis viral oncogene homolog
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
64,960 Da
3D Structure
ModBase 3D Structure for P15307
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-c-Rel antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-c-Rel antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-c-Rel antibody

Anti- c-Rel Picoband antibody, MBS178033, Western blotting
All lanes: Anti c-Rel (MBS178033) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted bind size: 69KD
Observed bind size: 69KD
Anti-c-REL Polyclonal Antibody – Cat# MBS178033

Immunohistochemistry (IHC) of anti-c-Rel antibody

Anti- c-Rel Picoband antibody, MBS178033,IHC(P)
IHC(P): Mouse Intestine Tissue
Anti-c-REL Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178033

Immunohistochemistry (IHC) of anti-c-Rel antibody

Anti- c-Rel Picoband antibody, MBS178033,IHC(P)
IHC(P): Rat Intestine Tissue
Anti-c-REL Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178033

Immunohistochemistry (IHC) of anti-c-Rel antibody

Anti- c-Rel Picoband antibody, MBS178033,IHC(P)
IHC(P): Human Mammary Cancer Tissue
Anti-c-REL Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178033

Product References and Citations for anti-c-Rel antibody

1. Belguise, K., Sonenshein, G. E. PKC-theta promotes c-Rel-driven mammary tumorigenesis in mice and humans by repressing estrogen receptor-alpha synthesis. J. Clin. Invest. 117: 4009-4021, 2007. 2. Gilmore TD, Kalaitzidis D, Liang MC, Starczynowski DT (March 2004). "The c-Rel transcription factor and B-cell proliferation: a deal with the devil". Oncogene 23 (13): 2275-86. 3. Ruben SM, Klement JF, Coleman TA, Maher M, Chen CH, Rosen CA (Jun 1992). "I-Rel: a novel rel-related protein that inhibits NF-kappa B transcriptional activity". Genes Dev 6 (5): 745-60.

Other Notes

Small volumes of anti-c-Rel antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for c-Rel purchase

MBS178033 is an antibody targeting c-Rel. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for c-Rel. It may not necessarily be applicable to this product.

NCBI GI #
585812
NCBI GeneID
19696
NCBI Accession #
P15307.2
UniProt Primary Accession #
P15307
UniProt Related Accession #
P15307
NCBI Official Full Name
Proto-oncogene c-Rel
NCBI Official Synonym Full Names
reticuloendotheliosis oncogene
NCBI Official Symbol
Rel
NCBI Official Synonym Symbols
c-Rel
UniProt Protein Name
Proto-oncogene c-Rel
Protein Family
Caspase
UniProt Gene Name
Rel
UniProt Entry Name
REL_MOUSE
NCBI Protein Information
proto-oncogene c-Rel

UniProt Comments for c-Rel

REL: a proto-oncogenic transcription factor of the nuclear factor-kappaB (NFkB) group. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. May play a role in differentiation and lymphopoiesis.

Protein type: Oncoprotein; Transcription factor

Cellular Component: cytoplasm; cytosol; nucleus; transcription factor complex

Molecular Function: chromatin binding; DNA binding; protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: cellular response to stress; cytokine production; I-kappaB kinase/NF-kappaB cascade; inflammatory response; innate immune response; negative regulation of interferon-beta production; negative regulation of transcription from RNA polymerase II promoter; positive regulation of interleukin-12 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent; response to cytokine stimulus; transcription from RNA polymerase II promoter; transcription, DNA-dependent
Show more

Research Articles on c-Rel

1. Loss of c-REL but not NF-kappaB2 prevents autoimmune disease driven by FasL mutation.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-c-Rel antibody

 Reference Product  PubMed Publications
 Nfkbia antibody  >236 publications with c-Rel and Nfkbia
 Cd40 antibody  >97 publications with c-Rel and Cd40
 Trp53 antibody  >49 publications with c-Rel and Trp53
 Stat3 antibody  >32 publications with c-Rel and Stat3
 Nfkbie antibody  >16 publications with c-Rel and Nfkbie
 Irf4 antibody  >15 publications with c-Rel and Irf4
 Bcl3 antibody  >9 publications with c-Rel and Bcl3
 Mapk8 antibody  >3 publications with c-Rel and Mapk8
 Nfkbib antibody  >3 publications with c-Rel and Nfkbib

Pathways associated with anti-c-Rel antibody

 Products by Pathway  Pathway Diagram
 Activation Of NF-kappaB In B Cells Pathway antibodies  Activation Of NF-kappaB In B Cells Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Apoptosis Signaling Pathway antibodies  Apoptosis Signaling Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 Downstream Signaling Events Of B Cell Receptor (BCR) Pathway antibodies  Downstream Signaling Events Of B Cell Receptor (BCR) Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 PI3K/Akt/mTOR Signaling Pathway antibodies  PI3K/Akt/mTOR Signaling Pathway Diagram
 PluriNetWork Pathway antibodies  PluriNetWork Pathway Diagram
 Ras Signaling Pathway antibodies  Ras Signaling Pathway Diagram
 Signaling By The B Cell Receptor (BCR) Pathway antibodies  Signaling By The B Cell Receptor (BCR) Pathway Diagram

Organs/Tissues associated with anti-c-Rel antibody

 Organ/Tissue Name  Pubmed Publications
 Spleen Antibodies  >138 publications with c-Rel and Spleen
 Bone Marrow Antibodies  >120 publications with c-Rel and Bone Marrow
 Embryonic Tissue Antibodies  >85 publications with c-Rel and Embryonic Tissue
 Eye Antibodies  >36 publications with c-Rel and Eye
 Testis Antibodies  >8 publications with c-Rel and Testis
 Uncharacterized Tissue Antibodies  >2 publications with c-Rel and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000