• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TRPV5 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178072

Description: Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human;Rat.Background: Transient receptor potential cation channel subfamily V member 5 is a protein that in… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TRPV5, Polyclonal Antibody
Full Product Name
Anti-TRPV5 Antibody
Product Gene Name
anti-TRPV5 antibody
Product Synonym Names
Transient receptor potential cation channel subfamily V member 5; Calcium transport protein 2; Calcium transporter 2; CAT 2; CAT2; ECAC 1; ECaC; ECAC1; Epithelial calcium channel 1; Osm 9 like TRP channel 3; Osm-9-like TRP channel 3; OTRPC 3; OTRPC3; Transient receptor potential cation channel subfamily V member 5; TRPV 5; TrpV5; TRPV5_HUMAN; transient receptor potential cation channel, subfamily V, member 5
Clonality
Polyclonal
Species Reactivity
Human, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
43,186 Da
OMIM
606679
3D Structure
ModBase 3D Structure for Q9NQA5
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-TRPV5 antibody
Western Blot (WB)
Application Notes for anti-TRPV5 antibody
Western Blot Concentration: 0.1-0.5ug/ml

Western Blot (WB) of anti-TRPV5 antibody

Anti- TRPV5 Picoband antibody, MBS178072, Western blotting
All lanes: Anti TRPV5 (MBS178072) at 0.5ug/ml
Lane 1: Rat Pancreas Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: SW620 Whole Cell Lysate at 40ug
Lane 5: COLO320 Whole Cell Lysate at 40ug
Lane 6: 293T Whole Cell Lysate at 40ug
Predicted bind size: 83KD
Observed bind size: 83KD
Anti-TRPV5 Polyclonal Antibody – Cat# MBS178072

Product References and Citations for anti-TRPV5 antibody

1. Clapham DE, Julius D, Montell C, Schultz G (Dec 2005). "International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels".Pharmacol. Rev. 57 (4): 427-50. 2. Müller D, Hoenderop JG, Meij IC, van den Heuvel LP, Knoers NV, den Hollander AI et al. (Nov 2000). "Molecular cloning, tissue distribution, and chromosomal mapping of the human epithelial Ca2+ channel (ECAC1)". Genomics 67 (1): 48-53. 3. Müller D, Hoenderop JG, Merkx GF, van Os CH, Bindels RJ (Sep 2000). "Gene structure and chromosomal mapping of human epithelial calcium channel". Biochem. Biophys. Res. Commun. 275 (1): 47-52.

Other Notes

Small volumes of anti-TRPV5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TRPV5 purchase

MBS178072 is an antibody targeting TRPV5. Reactive in Human, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for TRPV5. It may not necessarily be applicable to this product.

NCBI GI #
730229359
NCBI GeneID
56302
NCBI Accession #
NP_062815.3
UniProt Primary Accession #
Q9NQA5
UniProt Secondary Accession #
Q8N4C1; Q8NDW5; Q8NDX7; Q8NDX8; Q96PM6; A4D2H7; E9PBZ6
UniProt Related Accession #
Q9NQA5
GenBank Nucleotide #
NM_019841.6
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 5
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily V member 5
NCBI Official Symbol
TRPV5
NCBI Official Synonym Symbols
CAT2; ECAC1; OTRPC3
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 5
UniProt Synonym Protein Names
Calcium transport protein 2; CaT2; Epithelial calcium channel 1; ECaC; ECaC1; Osm-9-like TRP channel 3; OTRPC3
Protein Family
Transient receptor potential cation channel subfamily
UniProt Gene Name
TRPV5
UniProt Synonym Gene Names
ECAC1; TrpV5; CaT2; ECaC; ECaC1; OTRPC3
UniProt Entry Name
TRPV5_HUMAN
NCBI Protein Information
transient receptor potential cation channel subfamily V member 5

NCBI Summary for TRPV5

This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for TRPV5

TRPV5: Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating. Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV5 sub-subfamily.

Protein type: Channel, cation; Membrane protein, multi-pass; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q35

Cellular Component: apical plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: calcium channel activity; calmodulin binding; protein binding

Biological Process: calcium ion transport; protein tetramerization
Show more

Research Articles on TRPV5

1. Data found that a TRPV5 polymorphism (rs4236480) was observed to be associated with stone multiplicity of calcium nephrolithiasis, as the risk of stone multiplicity was higher in patients with the TT+CT genotype than in patients with the CC genotype

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-TRPV5 antibody

 Reference Product  PubMed Publications
 PTH antibody  >24 publications with TRPV5 and PTH
 CALB1 antibody  >23 publications with TRPV5 and CALB1
 TRPM7 antibody  >15 publications with TRPV5 and TRPM7
 TRPM4 antibody  >12 publications with TRPV5 and TRPM4
 LGALS1 antibody  >6 publications with TRPV5 and LGALS1
 WNK3 antibody  >3 publications with TRPV5 and WNK3
 BSPRY antibody  >2 publications with TRPV5 and BSPRY
 RAB11A antibody  >2 publications with TRPV5 and RAB11A
 FKBP4 antibody  >1 publications with TRPV5 and FKBP4

Pathways associated with anti-TRPV5 antibody

 Products by Pathway  Pathway Diagram
 Endocrine And Other Factor-regulated Calcium Reabsorption Pathway antibodies  Endocrine And Other Factor-regulated Calcium Reabsorption Pathway Diagram
 Endocrine And Other Factor-regulated Calcium Reabsorption Pathway antibodies  Endocrine And Other Factor-regulated Calcium Reabsorption Pathway Diagram
 Ion Channel Transport Pathway antibodies  Ion Channel Transport Pathway Diagram
 Osteoclast Signaling Pathway antibodies  Osteoclast Signaling Pathway Diagram
 Stimuli-sensing Channels Pathway antibodies  Stimuli-sensing Channels Pathway Diagram
 TRP Channels Pathway antibodies  TRP Channels Pathway Diagram
 Transmembrane Transport Of Small Molecules Pathway antibodies  Transmembrane Transport Of Small Molecules Pathway Diagram

Diseases associated with anti-TRPV5 antibody

 Disease Name  Pubmed Publications
 Hypercalciuria Antibodies  >53 publications with TRPV5 and Hypercalciuria
 Kidney Diseases Antibodies  >42 publications with TRPV5 and Kidney Diseases
 Hypertension Antibodies  >19 publications with TRPV5 and Hypertension
 Osteoporosis Antibodies  >16 publications with TRPV5 and Osteoporosis
 Hypocalcemia Antibodies  >14 publications with TRPV5 and Hypocalcemia
 Cardiovascular Diseases Antibodies  >9 publications with TRPV5 and Cardiovascular Diseases
 Pain Antibodies  >7 publications with TRPV5 and Pain
 Insulin Resistance Antibodies  >6 publications with TRPV5 and Insulin Resistance
 Renal Insufficiency Antibodies  >5 publications with TRPV5 and Renal Insufficiency
 Fibrosis Antibodies  >4 publications with TRPV5 and Fibrosis

Organs/Tissues associated with anti-TRPV5 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >74 publications with TRPV5 and Blood
 Lung Antibodies  >5 publications with TRPV5 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000