Anti-SPP1 Polyclonal Antibody – Cat# MBS178082

Anti- Osteopontin antibody, Western blotting
All lanes: Anti Osteopontin at 0.5ug/ml

Osteopontin (SPP1) Antibody – Polyclonal

Name: SPP1 Antibody; Polyclonal; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178082
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178082

Description: Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human;Mouse;Rat.Background: Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Osteopontin (SPP1), Polyclonal Antibody

Full Product Name

Anti-Osteopontin Antibody

Product Gene Name

anti-SPP1 antibody

Product Synonym Names

Osteopontin; BNSP; Bone sialoprotein 1; BSP I; BSPI; Early T lymphocyte activation 1; ETA 1; ETA1; MGC110940; Nephropontin; OPN; Osteopontin; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; OSTP_HUMAN; PSEC0156; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); Secreted phosphoprotein 1; SPP 1; SPP-1; SPP1; SPP1/CALPHA1 fusion; Urinary stone protein; Uropontin; secreted phosphoprotein 1

Clonality

Polyclonal

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

33,843 Da

OMIM

166490

3D Structure

ModBase 3D Structure for P10451

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-SPP1 antibody

Western Blot (WB), ELISA (EIA)

Application Notes for anti-SPP1 antibody

ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-SPP1 antibody

1. "Entrez Gene: SPP1 secreted phosphoprotein 1". 2. Reinholt FP, Hultenby K, Oldberg A, Heinegård D (June 1990). "Osteopontin--a possible anchor of osteoclasts to bone". Proc. Natl. Acad. Sci. U.S.A. 87 (12): 4473-5. 3. Wang KX, Denhardt DT (2008). "Osteopontin: role in immune regulation and stress responses". Cytokine Growth Factor Rev. 19 (5-6): 333-45.

Other Notes

Small volumes of anti-SPP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SPP1 purchase

MBS178082 is an antibody targeting SPP1. Also known as Anti-Osteopontin Antibody. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for SPP1. It may not necessarily be applicable to this product.

NCBI GI #

4759166

NCBI GeneID

6696

NCBI Accession #

NP_000573.1

UniProt Primary Accession #

P10451

UniProt Secondary Accession #

Q15681; Q15682; Q15683; Q4W597; Q567T5; Q8NBK2; Q96IZ1; B2RDA1

UniProt Related Accession #

P10451

GenBank Nucleotide #

NM_000582.2

NCBI Official Full Name

osteopontin isoform OPN-b

NCBI Official Synonym Full Names

secreted phosphoprotein 1

NCBI Official Symbol

SPP1

NCBI Official Synonym Symbols

OPN; BNSP; BSPI; ETA-1

UniProt Protein Name

Osteopontin

UniProt Synonym Protein Names

Bone sialoprotein 1; Nephropontin; Secreted phosphoprotein 1; SPP-1; Urinary stone protein; Uropontin

Protein Family

COMPASS component

UniProt Gene Name

SPP1

UniProt Synonym Gene Names

BNSP; OPN; SPP-1

UniProt Entry Name

OSTP_HUMAN

NCBI Protein Information

osteopontin

NCBI Summary for SPP1

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

UniProt Comments for SPP1

osteopontin: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Belongs to the osteopontin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: cell projection; extracellular region; extracellular space; perinuclear region of cytoplasm

Molecular Function: cytokine activity; extracellular matrix binding; protein binding

Biological Process: biomineral formation; cell adhesion; decidualization; embryo implantation; extracellular matrix disassembly; extracellular matrix organization and biogenesis; inflammatory response; negative regulation of collateral sprouting of intact axon in response to injury; osteoblast differentiation; positive regulation of bone resorption; response to steroid hormone stimulus; response to vitamin D

Research Articles on SPP1

1. Results show high matrix stiffness upregulated OPN expression in hepatocellular carcinoma (HCC) via the integrin beta1/GSK-3beta/beta-catenin signaling pathway and highlight the physicomechanical and biochemical signals contributing to OPN expression in HCC cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SPP1 antibody

Reference Product	PubMed Publications
RUNX2 antibody	>161 publications with SPP1 and RUNX2
CD44 antibody	>136 publications with SPP1 and CD44
BMP2 antibody	>80 publications with SPP1 and BMP2
THBS1 antibody	>14 publications with SPP1 and THBS1
ACP5 antibody	>12 publications with SPP1 and ACP5
MMP7 antibody	>11 publications with SPP1 and MMP7
TP53 antibody	>4 publications with SPP1 and TP53
ITGB1 antibody	>3 publications with SPP1 and ITGB1
ITGAV antibody	>3 publications with SPP1 and ITGAV

Pathways associated with anti-SPP1 antibody

Products by Pathway	Pathway Diagram
BDNF Signaling Pathway antibodies	BDNF Signaling Pathway Diagram
Degradation Of The Extracellular Matrix Pathway antibodies	Degradation Of The Extracellular Matrix Pathway Diagram
Direct P53 Effectors Pathway antibodies	Direct P53 Effectors Pathway Diagram
ECM-receptor Interaction Pathway antibodies	ECM-receptor Interaction Pathway Diagram
ECM-receptor Interaction Pathway antibodies	ECM-receptor Interaction Pathway Diagram
Endochondral Ossification Pathway antibodies	Endochondral Ossification Pathway Diagram
Extracellular Matrix Organization Pathway antibodies	Extracellular Matrix Organization Pathway Diagram
FGF Signaling Pathway antibodies	FGF Signaling Pathway Diagram
Focal Adhesion Pathway antibodies	Focal Adhesion Pathway Diagram
Focal Adhesion Pathway antibodies	Focal Adhesion Pathway Diagram

Diseases associated with anti-SPP1 antibody

Disease Name	Pubmed Publications
Inflammation Antibodies	>266 publications with SPP1 and Inflammation
Kidney Diseases Antibodies	>233 publications with SPP1 and Kidney Diseases
Fibrosis Antibodies	>166 publications with SPP1 and Fibrosis
Neoplasm Metastasis Antibodies	>140 publications with SPP1 and Neoplasm Metastasis
Necrosis Antibodies	>132 publications with SPP1 and Necrosis
Calcinosis Antibodies	>117 publications with SPP1 and Calcinosis
Adenocarcinoma Antibodies	>113 publications with SPP1 and Adenocarcinoma
Heart Diseases Antibodies	>109 publications with SPP1 and Heart Diseases
Neoplasms, Experimental Antibodies	>85 publications with SPP1 and Neoplasms, Experimental
Breast Neoplasms Antibodies	>79 publications with SPP1 and Breast Neoplasms

Organs/Tissues associated with anti-SPP1 antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>1114 publications with SPP1 and Bone
Blood Antibodies	>565 publications with SPP1 and Blood
Kidney Antibodies	>369 publications with SPP1 and Kidney
Vascular Antibodies	>358 publications with SPP1 and Vascular
Connective Tissue Antibodies	>346 publications with SPP1 and Connective Tissue
Muscle Antibodies	>295 publications with SPP1 and Muscle
Bone Marrow Antibodies	>200 publications with SPP1 and Bone Marrow
Mouth Antibodies	>189 publications with SPP1 and Mouth
Liver Antibodies	>138 publications with SPP1 and Liver
Heart Antibodies	>138 publications with SPP1 and Heart