• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RRM2 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178106

Description: Rabbit IgG polyclonal antibody for Ribonucleoside-diphosphate reductase subunit M2(RRM2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RRM2, Polyclonal Antibody
Full Product Name
Anti-RRM2 Antibody
Product Gene Name
anti-RRM2 antibody
Product Synonym Names
Ribonucleoside-diphosphate reductase subunit M2; R2; Ribonucleoside-diphosphate reductase subunit M2; Ribonucleotide reductase M2; Ribonucleotide reductase M2 polypeptide; Ribonucleotide reductase M2 subunit; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RIR2_HUMAN; RR2; RR2M; RRM2; ribonucleotide reductase M2
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
51,093 Da
OMIM
180390
3D Structure
ModBase 3D Structure for P31350
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-RRM2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-RRM2 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-RRM2 antibody

Anti- RRM2 Picoband antibody, MBS178106, Western blotting
All lanes: Anti RRM2 (MBS178106) at 0.5ug/ml
Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 2: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 3: A431 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Predicted bind size: 50KD
Observed bind size: 50KD
Anti-RRM2 Polyclonal Antibody – Cat# MBS178106

Immunohistochemistry (IHC) of anti-RRM2 antibody

Anti- RRM2 Picoband antibody, MBS178106, IHC(P)
IHC(P): Human Mammary Cancer Tissue
Anti-RRM2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178106

Product References and Citations for anti-RRM2 antibody

1. "Entrez Gene: ribonucleotide reductase M2". 2. Pavloff, N., Rivard, D., Masson, S., Shen, S.-H., Mes-Masson, A.-M. Sequence analysis of the large and small subunits of human ribonucleotide reductase. DNA Seq. 2: 227-234, 1992. 3. Yang-Feng, T. L., Thelander, L., Lewis, W. H., Srinivasan, P. R., Francke, U. Gene localization of the ribonucleotide reductase M2 subunit and of related and co-amplified sequences on human and mouse chromosomes. (Abstract) Am. J. Hum. Genet. 39: A174 only, 1986.

Other Notes

Small volumes of anti-RRM2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RRM2 purchase

MBS178106 is an antibody targeting RRM2. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for RRM2. It may not necessarily be applicable to this product.

NCBI GI #
4557845
NCBI GeneID
6241
NCBI Accession #
NP_001025.1
UniProt Primary Accession #
P31350
UniProt Secondary Accession #
Q5WRU7; B2R9B5; J3KP43
UniProt Related Accession #
P31350
GenBank Nucleotide #
NM_001034.3
NCBI Official Full Name
ribonucleoside-diphosphate reductase subunit M2 isoform 2
NCBI Official Synonym Full Names
ribonucleotide reductase regulatory subunit M2
NCBI Official Symbol
RRM2
NCBI Official Synonym Symbols
R2; RR2; RR2M
UniProt Protein Name
Ribonucleoside-diphosphate reductase subunit M2
UniProt Synonym Protein Names
Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit
Protein Family
Ribonucleoside-diphosphate reductase
UniProt Gene Name
RRM2
UniProt Synonym Gene Names
RR2
UniProt Entry Name
RIR2_HUMAN
NCBI Protein Information
ribonucleoside-diphosphate reductase subunit M2

NCBI Summary for RRM2

This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]
Show more

UniProt Comments for RRM2

RRM2: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. Belongs to the ribonucleoside diphosphate reductase small chain family.

Protein type: Nucleotide Metabolism - purine; Other Amino Acids Metabolism - glutathione; Nucleotide Metabolism - pyrimidine; EC 1.17.4.1; Oxidoreductase

Chromosomal Location of Human Ortholog: 2p25-p24

Cellular Component: cytoplasm; cytosol; nucleoplasm; nucleus; ribonucleoside-diphosphate reductase complex

Molecular Function: metal ion binding; protein binding; ribonucleoside-diphosphate reductase activity

Biological Process: deoxyribonucleoside diphosphate metabolic process; deoxyribonucleotide biosynthetic process; DNA replication; G1/S transition of mitotic cell cycle; G1/S-specific transcription in mitotic cell cycle; nucleobase, nucleoside and nucleotide interconversion; protein heterotetramerization
Show more

Research Articles on RRM2

1. In non-small cell lung cancer, RRM2 expression was predictive of disease-specific survival in women, non-smokers and former smokers. Higher expression was associated with worse survival. This was not the case for men, and current or recently quit smokers.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RRM2 antibody

 Reference Product  PubMed Publications
 RRM1 antibody  >141 publications with RRM2 and RRM1
 CDK1 antibody  >6 publications with RRM2 and CDK1
 PCNA antibody  >4 publications with RRM2 and PCNA
 TYMS antibody  >2 publications with RRM2 and TYMS
 CDC6 antibody  >1 publications with RRM2 and CDC6
 TXN antibody  >1 publications with RRM2 and TXN

Pathways associated with anti-RRM2 antibody

 Products by Pathway  Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 E2F Mediated Regulation Of DNA Replication Pathway antibodies  E2F Mediated Regulation Of DNA Replication Pathway Diagram
 E2F Transcription Factor Network Pathway antibodies  E2F Transcription Factor Network Pathway Diagram
 Fluoropyrimidine Activity Pathway antibodies  Fluoropyrimidine Activity Pathway Diagram
 G1/S Transition Pathway antibodies  G1/S Transition Pathway Diagram
 G1/S-Specific Transcription Pathway antibodies  G1/S-Specific Transcription Pathway Diagram
 Glutathione Metabolism Pathway antibodies  Glutathione Metabolism Pathway Diagram
 Glutathione Metabolism Pathway antibodies  Glutathione Metabolism Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram

Diseases associated with anti-RRM2 antibody

 Disease Name  Pubmed Publications
 Adenocarcinoma Antibodies  >34 publications with RRM2 and Adenocarcinoma
 Breast Neoplasms Antibodies  >23 publications with RRM2 and Breast Neoplasms
 Lung Neoplasms Antibodies  >18 publications with RRM2 and Lung Neoplasms
 Lung Diseases Antibodies  >16 publications with RRM2 and Lung Diseases
 Neoplasms, Experimental Antibodies  >13 publications with RRM2 and Neoplasms, Experimental
 Colorectal Neoplasms Antibodies  >12 publications with RRM2 and Colorectal Neoplasms
 Nervous System Diseases Antibodies  >10 publications with RRM2 and Nervous System Diseases
 Carcinoma, Hepatocellular Antibodies  >9 publications with RRM2 and Carcinoma, Hepatocellular
 Liver Diseases Antibodies  >7 publications with RRM2 and Liver Diseases
 Liver Neoplasms Antibodies  >6 publications with RRM2 and Liver Neoplasms

Organs/Tissues associated with anti-RRM2 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >25 publications with RRM2 and Lung
 Blood Antibodies  >16 publications with RRM2 and Blood
 Liver Antibodies  >11 publications with RRM2 and Liver
 Brain Antibodies  >10 publications with RRM2 and Brain
 Lymph Node Antibodies  >8 publications with RRM2 and Lymph Node
 Bone Antibodies  >8 publications with RRM2 and Bone
 Lymph Antibodies  >8 publications with RRM2 and Lymph
 Muscle Antibodies  >7 publications with RRM2 and Muscle
 Prostate Antibodies  >6 publications with RRM2 and Prostate
 Nerve Antibodies  >5 publications with RRM2 and Nerve
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000