• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

IDO1 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178128

Background: IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
IDO1, Polyclonal Antibody
Full Product Name
Anti-IDO1 Antibody
Product Gene Name
anti-IDO1 antibody
Clonality
Polyclonal
Isotype
Rabbit IgG
Species Reactivity
Human
Form/Format
Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
OMIM
147435
3D Structure
ModBase 3D Structure for P14902
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-IDO1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-IDO1 antibody
Western Blot: Concentration: 0.1-0.5ug/ml , Tested Species: Human
Immunohistochemistry (IHC) Paraffin: Concentration: 0.5-1ug/ml , Tested Species: Human, Antigen Retrieval: By Heat
Immunocytochemistry: Concentration: 2ug/mL , Tested Species: Human
Immunofluorescence: Concentration: 2ug, Tested Sepcies: Human
Flow Cytometry: 1-3ug/1x106, Tested Species: Human

Tested Species: In house tested species with positive results
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0 , for 20mins is required for the staining of formalin/paraffin sections
Other applications have not been tested
Optimal dilutions should be determined by the end users.

Western Blot (WB) of anti-IDO1 antibody

Anti- IDO1 Picoband antibody, MBS178128, Western blotting
All lanes: Anti IDO1 (MBS178128) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Spleen Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Lane 6: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
Anti-IDO1 Polyclonal Antibody – Cat# MBS178128

Immunohistochemistry (IHC) of anti-IDO1 antibody

Anti- IDO1 Picoband antibody, MBS178128, IHC(P)
IHC(P): Human Lung Cancer Tissue
Anti-IDO1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178128

Product References and Citations for anti-IDO1 antibody

1. Burkin, D. J., Kimbro, K. S., Barr, B. L., Jones, C., Taylor, M. W., Gupta, S. L. Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8. Genomics 17: 262-263, 1993. 2. Dai, W., Gupta, S. L. Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA. Biochem. Biophys. Res. Commun. 168: 1-8, 1990. 3. Fallarino, F., Grohmann, U., Hwang, K. W., Orabona, C., Vacca, C., Bianchi, R., Belladonna, M. L., Fioretti, M. C., Alegre, M.-L., Puccetti, P. Modulation of tryptophan catabolism by regulatory T cells. Nature Immun. 4: 1206-1212, 2003.

Other Notes

Small volumes of anti-IDO1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IDO1 purchase

MBS178128 is an antibody targeting IDO1. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for IDO1. It may not necessarily be applicable to this product.

NCBI GI #
4504577
NCBI GeneID
3620
NCBI Accession #
NP_002155.1
UniProt Primary Accession #
P14902
UniProt Secondary Accession #
Q540B4; E5RGR8; F6M9T7
UniProt Related Accession #
P14902
GenBank Nucleotide #
NM_002164.5
NCBI Official Full Name
indoleamine 2,3-dioxygenase 1
NCBI Official Synonym Full Names
indoleamine 2,3-dioxygenase 1
NCBI Official Symbol
IDO1
NCBI Official Synonym Symbols
IDO; INDO; IDO-1
UniProt Protein Name
Indoleamine 2,3-dioxygenase 1
UniProt Synonym Protein Names
Indoleamine-pyrrole 2,3-dioxygenase
Protein Family
Indoleamine 2,3-dioxygenase
UniProt Gene Name
IDO1
UniProt Synonym Gene Names
IDO; INDO; IDO-1
UniProt Entry Name
I23O1_HUMAN
NCBI Protein Information
indoleamine 2,3-dioxygenase 1

NCBI Summary for IDO1

This gene encodes indoleamine 2,3-dioxygenase (IDO) - a heme enzyme that catalyzes the first and rate-limiting step in tryptophan catabolism to N-formyl-kynurenine. This enzyme acts on multiple tryptophan substrates including D-tryptophan, L-tryptophan, 5-hydroxy-tryptophan, tryptamine, and serotonin. This enzyme is thought to play a role in a variety of pathophysiological processes such as antimicrobial and antitumor defense, neuropathology, immunoregulation, and antioxidant activity. Through its expression in dendritic cells, monocytes, and macrophages this enzyme modulates T-cell behavior by its peri-cellular catabolization of the essential amino acid tryptophan.[provided by RefSeq, Feb 2011]
Show more

UniProt Comments for IDO1

INDO: Catalyzes the cleavage of the pyrrol ring of tryptophan and incorporates both atoms of a molecule of oxygen. Belongs to the indoleamine 2,3-dioxygenase family.

Protein type: Amino Acid Metabolism - tryptophan; Oxidoreductase; EC 1.13.11.52; Cell cycle regulation

Chromosomal Location of Human Ortholog: 8p12-p11

Cellular Component: cytosol; smooth muscle contractile fiber; stereocilium bundle

Molecular Function: electron carrier activity; heme binding; indoleamine 2,3-dioxygenase activity; metal ion binding; tryptophan 2,3-dioxygenase activity

Biological Process: cytokine production during acute inflammatory response; female pregnancy; immune system process; multicellular organismal response to stress; negative regulation of interleukin-10 production; negative regulation of T cell proliferation; positive regulation of chronic inflammatory response; positive regulation of interleukin-12 production; positive regulation of T cell tolerance induction; positive regulation of T-helper 2 type immune response; regulation of activated T cell proliferation; response to lipopolysaccharide; tryptophan catabolic process; tryptophan catabolic process to kynurenine
Show more

Research Articles on IDO1

1. We conclude that autophagy, but not IDO and IFNgamma responsiveness, is dispensable for MSC's immunosuppressive properties. MSCs from CD subjects are functionally analogous to those of healthy individuals

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IDO1 antibody

 Reference Product  PubMed Publications
 KYNU antibody  >3 publications with IDO1 and KYNU
 CYP1A1 antibody  >2 publications with IDO1 and CYP1A1
 TPH1 antibody  >2 publications with IDO1 and TPH1
 CYP1A2 antibody  >1 publications with IDO1 and CYP1A2

Pathways associated with anti-IDO1 antibody

 Products by Pathway  Pathway Diagram
 African Trypanosomiasis Pathway antibodies  African Trypanosomiasis Pathway Diagram
 African Trypanosomiasis Pathway antibodies  African Trypanosomiasis Pathway Diagram
 Histidine, Lysine, Phenylalanine, Tyrosine, Proline And Tryptophan Catabolism Pathway antibodies  Histidine, Lysine, Phenylalanine, Tyrosine, Proline And Tryptophan Catabolism Pathway Diagram
 L-kynurenine Degradation Pathway antibodies  L-kynurenine Degradation Pathway Diagram
 L-tryptophan Degradation III (eukaryotic) Pathway antibodies  L-tryptophan Degradation III (eukaryotic) Pathway Diagram
 L-tryptophan Degradation XI (mammalian, Via Kynurenine) Pathway antibodies  L-tryptophan Degradation XI (mammalian, Via Kynurenine) Pathway Diagram
 L-tryptophan Degradation To 2-amino-3-carboxymuconate Semialdehyde Pathway antibodies  L-tryptophan Degradation To 2-amino-3-carboxymuconate Semialdehyde Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Amino Acids And Derivatives Pathway antibodies  Metabolism Of Amino Acids And Derivatives Pathway Diagram

Diseases associated with anti-IDO1 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >68 publications with IDO1 and Inflammation
 Neoplasms, Experimental Antibodies  >12 publications with IDO1 and Neoplasms, Experimental
 Colitis Antibodies  >11 publications with IDO1 and Colitis
 Neurodegenerative Diseases Antibodies  >8 publications with IDO1 and Neurodegenerative Diseases
 Lung Diseases Antibodies  >8 publications with IDO1 and Lung Diseases
 Necrosis Antibodies  >7 publications with IDO1 and Necrosis
 Liver Diseases Antibodies  >6 publications with IDO1 and Liver Diseases
 Breast Neoplasms Antibodies  >6 publications with IDO1 and Breast Neoplasms
 Cognition Disorders Antibodies  >4 publications with IDO1 and Cognition Disorders
 Endometriosis Antibodies  >4 publications with IDO1 and Endometriosis

Organs/Tissues associated with anti-IDO1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >32 publications with IDO1 and Brain
 Bone Antibodies  >20 publications with IDO1 and Bone
 Lung Antibodies  >18 publications with IDO1 and Lung
 Liver Antibodies  >12 publications with IDO1 and Liver
 Intestine Antibodies  >8 publications with IDO1 and Intestine
 Uterus Antibodies  >7 publications with IDO1 and Uterus
 Kidney Antibodies  >6 publications with IDO1 and Kidney
 Placenta Antibodies  >6 publications with IDO1 and Placenta
 Embryonic Tissue Antibodies  >4 publications with IDO1 and Embryonic Tissue
 Eye Antibodies  >4 publications with IDO1 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000