• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Stathmin 1 (STMN1) Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178178

Description: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Stathmin 1 (STMN1), Polyclonal Antibody
Full Product Name
Anti-Stathmin 1 Antibody
Product Gene Name
anti-STMN1 antibody
Product Synonym Names
Stathmin; C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; OP18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; PP17; PP19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin; Stathmin1; STMN 1; STMN1; STMN1_HUMAN; stathmin 1
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
19,824 Da
OMIM
151442
3D Structure
ModBase 3D Structure for P16949
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-STMN1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-STMN1 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-STMN1 antibody

Anti- Stathmin 1 Picoband antibody, MBS178178, Western blotting
All lanes: Anti Stathmin 1 (MBS178178) at 0.5ug/ml
Lane 1: Mouse Brain Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: MM231 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 17KD
Observed bind size: 17KD
Anti-STMN1 Polyclonal Antibody – Cat# MBS178178

Immunohistochemistry (IHC) of anti-STMN1 antibody

nti- Stathmin 1 Picoband antibody, MBS178178, IHC(P)
IHC(P): Mouse Testis Tissue
Anti-STMN1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178178

Immunohistochemistry (IHC) of anti-STMN1 antibody

nti- Stathmin 1 Picoband antibody, MBS178178, IHC(P)
IHC(P): Rat Brain Tissue
Anti-STMN1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178178

Immunohistochemistry (IHC) of anti-STMN1 antibody

nti- Stathmin 1 Picoband antibody, MBS178178, IHC(P)
IHC(P): Human Mammary Cancer Tissue
Anti-STMN1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178178

Product References and Citations for anti-STMN1 antibody

1. Cassimeris L (February 2002). "The oncoprotein 18/stathmin family of microtubule destabilizers". Curr. Opin. Cell Biol. 14 (1): 18-24. 2. Clément MJ, Jourdain I, Lachkar S, Savarin P, Gigant B, Knossow M, Toma F, Sobel A, Curmi PA (November 2005). "N-terminal stathmin-like peptides bind tubulin and impede microtubule assembly". Biochemistry 44 (44): 14616-25. 3. Jourdain L, Curmi P, Sobel A, Pantaloni D, Carlier MF (September 1997). "Stathmin: a tubulin-sequestering protein which forms a ternary T2S complex with two tubulin molecules". Biochemistry 36 (36): 10817-21.

Other Notes

Small volumes of anti-STMN1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for STMN1 purchase

MBS178178 is an antibody targeting STMN1. Also known as Anti-Stathmin 1 Antibody. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for STMN1. It may not necessarily be applicable to this product.

NCBI GI #
224451142
NCBI GeneID
3925
NCBI Accession #
NP_001138926.1
UniProt Primary Accession #
P16949
UniProt Secondary Accession #
A2A2D1; B2R4E7; B7Z8N4; D3DPJ5
UniProt Related Accession #
P16949
GenBank Nucleotide #
NM_001145454.2
NCBI Official Full Name
stathmin isoform b
NCBI Official Synonym Full Names
stathmin 1
NCBI Official Symbol
STMN1
NCBI Official Synonym Symbols
Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
UniProt Protein Name
Stathmin
UniProt Synonym Protein Names
Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; Op18; Phosphoprotein p19; pp19; Prosolin; Protein Pr22; pp17
Protein Family
Stathmin
UniProt Gene Name
STMN1
UniProt Synonym Gene Names
C1orf215; LAP18; OP18; Op18; pp19
UniProt Entry Name
STMN1_HUMAN
NCBI Protein Information
stathmin

NCBI Summary for STMN1

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
Show more

UniProt Comments for STMN1

STMN1: a microtubule-associated protein involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Phosphorylation reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, nonleukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: cytoplasm; cytosol; intracellular; membrane; microtubule; neuron projection

Molecular Function: protein binding; signal transducer activity; tubulin binding

Biological Process: axonogenesis; brain development; cytokinesis after mitosis; microtubule depolymerization; mitotic spindle organization and biogenesis; negative regulation of microtubule polymerization; neurite development; positive regulation of cell motility; regulation of cytoskeleton organization and biogenesis; response to virus; signal transduction
Show more

Research Articles on STMN1

1. stathmin-1 may play a key role in regulating trophoblast invasion

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-STMN1 antibody

 Reference Product  PubMed Publications
 CCNB1 antibody  >2 publications with STMN1 and CCNB1
 AURKB antibody  >1 publications with STMN1 and AURKB
 CDK1 antibody  >1 publications with STMN1 and CDK1
 CAMK4 antibody  >1 publications with STMN1 and CAMK4

Pathways associated with anti-STMN1 antibody

 Products by Pathway  Pathway Diagram
 Aurora B Signaling Pathway antibodies  Aurora B Signaling Pathway Diagram
 Integrated Pancreatic Cancer Pathway antibodies  Integrated Pancreatic Cancer Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MicroRNAs In Cancer Pathway antibodies  MicroRNAs In Cancer Pathway Diagram
 MicroRNAs In Cancer Pathway antibodies  MicroRNAs In Cancer Pathway Diagram
 RB In Cancer Pathway antibodies  RB In Cancer Pathway Diagram
 Regulation Of Microtubule Cytoskeleton Pathway antibodies  Regulation Of Microtubule Cytoskeleton Pathway Diagram
 Signaling Mediated By P38-gamma And P38-delta Pathway antibodies  Signaling Mediated By P38-gamma And P38-delta Pathway Diagram

Diseases associated with anti-STMN1 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >82 publications with STMN1 and Carcinoma
 Adenocarcinoma Antibodies  >33 publications with STMN1 and Adenocarcinoma
 Breast Neoplasms Antibodies  >31 publications with STMN1 and Breast Neoplasms
 Lung Neoplasms Antibodies  >24 publications with STMN1 and Lung Neoplasms
 Nervous System Diseases Antibodies  >17 publications with STMN1 and Nervous System Diseases
 Liver Neoplasms Antibodies  >15 publications with STMN1 and Liver Neoplasms
 Liver Diseases Antibodies  >14 publications with STMN1 and Liver Diseases
 Carcinoma, Hepatocellular Antibodies  >12 publications with STMN1 and Carcinoma, Hepatocellular
 Neoplasms, Experimental Antibodies  >12 publications with STMN1 and Neoplasms, Experimental
 Prostatic Neoplasms Antibodies  >11 publications with STMN1 and Prostatic Neoplasms

Organs/Tissues associated with anti-STMN1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >54 publications with STMN1 and Brain
 Blood Antibodies  >46 publications with STMN1 and Blood
 Nerve Antibodies  >37 publications with STMN1 and Nerve
 Lung Antibodies  >34 publications with STMN1 and Lung
 Lymph Node Antibodies  >24 publications with STMN1 and Lymph Node
 Lymph Antibodies  >24 publications with STMN1 and Lymph
 Liver Antibodies  >21 publications with STMN1 and Liver
 Prostate Antibodies  >17 publications with STMN1 and Prostate
 Bone Antibodies  >10 publications with STMN1 and Bone
 Stomach Antibodies  >8 publications with STMN1 and Stomach
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000