Rabbit Anti-ERV31 Polyclonal Antibody – Cat# MBS178214

Anti- ERV31 antibody, Western blotting

ERV31 Antibody – Rabbit Polyclonal

Name: ERV31 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178214
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178214

HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ERV31, Polyclonal Antibody

Full Product Name

Anti-ERV31 Antibody

Product Gene Name

anti-ERV31 antibody

Product Synonym Names

Endogenous retrovirus group 3 member 1 Env polyprotein; Endogenous retroviral sequence 3; Endogenous retrovirus group 3 member 1; ENR1_HUMAN; Envelope polyprotein; envR; ERV R; ERV-3 envelope protein; ERV-R envelope protein; ERV3 1 envelope protein; ERV3; ERV3 envelope protein; ERV3-1; ERVR; FLJ23884; HERV R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; HERVR; SU; TM; Transmembrane protein; endogenous retrovirus group 3, member 1

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg NaN₃.

Purity/Purification

Immunogen Affinity Purified

Specificity

No cross reactivity with other proteins.

Preparation and Storage

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

3D Structure

ModBase 3D Structure for Q14264

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Relevant Detection Systems

The lab provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit (please intquire) in Western Blot (WB).

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-ERV31 antibody

Western Blot (WB)
Other applications have not been tested.

Application Notes for anti-ERV31 antibody

WB: Concentration: 0.1-0.5ug/ml / Tested Species: Human
Tested Species: In-house tested species with positive results.
Optimal dilutions should be determined by end users.

Product References and Citations for anti-ERV31 antibody

1. Kato, N., Shimotohno, K., Van Leeuwen, D., Cohen, M. Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Kruppel. Molec. Cell. Biol. 10: 4401-4405, 1990. 2. Kim, H.-S., Crow, T. J., Hyun, B.-H. Assignment of the endogenous retrovirus HERV-R (ERV3) to human chromosome 7q11.2 by radiation hybrid mapping. Cytogenet. Cell Genet. 89: 10 only, 2000. 3. O'Connell C, O'Brien S, Nash WG, Cohen M (Dec 1984). "ERV3, a full-length human endogenous provirus: chromosomal localization and evolutionary relationships". Virology 138 (2): 225-35.

Other Notes

Small volumes of anti-ERV31 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ERV31 purchase

MBS178214 is an antibody targeting ERV31. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for ERV31. It may not necessarily be applicable to this product.

NCBI GI #

145651814

NCBI GeneID

2086

NCBI Accession #

NP_001007254.2

UniProt Primary Accession #

Q14264

UniProt Related Accession #

Q14264

GenBank Nucleotide #

NM_001007253.3

NCBI Official Full Name

endogenous retrovirus group 3 member 1 Env polyprotein

NCBI Official Synonym Full Names

endogenous retrovirus group 3 member 1

NCBI Official Symbol

ERV3-1

NCBI Official Synonym Symbols

ERV3; ERVR; envR; ERV-R; HERVR; HERV-R

UniProt Protein Name

Endogenous retrovirus group 3 member 1 Env polyprotein

UniProt Synonym Protein Names

ERV-3 envelope protein; ERV3 envelope protein

UniProt Gene Name

ERV3-1

UniProt Synonym Gene Names

ERV3; ERV3 envelope protein; ERV-R envelope protein; SU; TM

UniProt Entry Name

ENR1_HUMAN

NCBI Protein Information

endogenous retrovirus group 3 member 1 Env polyprotein

NCBI Summary for ERV31

The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma. [provided by RefSeq, Jul 2008]

UniProt Comments for ERV31

ERV3: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro. Belongs to the gamma type-C retroviral envelope protein family. HERV class-I R env subfamily.

Chromosomal Location of Human Ortholog: 7q11.2

Cellular Component: viral envelope

Research Articles on ERV31

1. Letter: report elevated ERV3-1 levels in colorectal neoplasms.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.