• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BMP5 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178341

Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human;Mouse;Rat.Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BMP5, Polyclonal Antibody
Full Product Name
Anti-BMP5 Antibody
Product Gene Name
anti-BMP5 antibody
Product Synonym Names
Bone morphogenetic protein 5; BMP 5; BMP-5; Bmp5; BMP5_HUMAN; Bone morphogenetic protein 5; MGC34244; bone morphogenetic protein 5
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
47,670 Da
OMIM
112265
3D Structure
ModBase 3D Structure for P22003
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-BMP5 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
Application Notes for anti-BMP5 antibody
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-BMP5 antibody

Anti- BMP-5 Picoband antibody, MBS178341, Western blotting
All lanes: Anti BMP-5 (MBS178341) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 51KD
Observed bind size: 51KD
Anti-BMP5 Polyclonal Antibody – Cat# MBS178341

Immunohistochemistry (IHC) of anti-BMP5 antibody

Anti- BMP-5 Picoband antibody, MBS178341, IHC(P)
IHC(P): Mouse Liver Tissue
Anti-BMP5 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178341

Immunohistochemistry (IHC) of anti-BMP5 antibody

Anti- BMP5 Picoband antibody, MBS178341, IHC(P)
IHC(P): Rat Lung Tissue
Anti-BMP5 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178341

Immunohistochemistry (IHC) of anti-BMP5 antibody

Anti- BMP5 Picoband antibody, MBS178341, IHC(P)
IHC(P): Human Lung Cancer Tissue
Anti-BMP5 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178341

Flow Cytometry (FC/FACS) of anti-BMP5 antibody

Figure 5. Flow Cytometry analysis of U20S cells using anti-BMP5 antibody (MBS178341).
Overlay histogram showing U20S cells stained with MBS178341 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-BMP5 Antibody (MBS178341,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Anti-BMP5 Polyclonal Antibody, Flow Cytometry (FC/FACS) – Cat# MBS178341

Product References and Citations for anti-BMP5 antibody

1. "Entrez Gene: BMP5 bone morphogenetic protein 5". 2. Beck HN, Drahushuk K, Jacoby DB, Higgins D, Lein PJ (Mar 2003). "Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons". BMC Neurosci 2: 12. 3. Hahn GV, Cohen RB, Wozney JM, Levitz CL, Shore EM, Zasloff MA, Kaplan FS (Dec 1992). "A bone morphogenetic protein subfamily: chromosomal localization of human genes for BMP5, BMP6, and BMP7". Genomics 14 (3): 759-62.

Other Notes

Small volumes of anti-BMP5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for BMP5 purchase

MBS178341 is an antibody targeting BMP5. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for BMP5. It may not necessarily be applicable to this product.

NCBI GI #
10835091
NCBI GeneID
653
NCBI Accession #
NP_066551.1
UniProt Primary Accession #
P22003
UniProt Secondary Accession #
Q9H547; Q9NTM5; B4E0Y4
UniProt Related Accession #
P22003
GenBank Nucleotide #
NM_021073.2
NCBI Official Full Name
bone morphogenetic protein 5 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 5
NCBI Official Symbol
BMP5
UniProt Protein Name
Bone morphogenetic protein 5
Protein Family
Bone morphogenetic protein
UniProt Gene Name
BMP5
UniProt Synonym Gene Names
BMP-5
UniProt Entry Name
BMP5_HUMAN
NCBI Protein Information
bone morphogenetic protein 5

NCBI Summary for BMP5

This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for BMP5

BMP5: Induces cartilage and bone formation. Belongs to the TGF-beta family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: extracellular space

Molecular Function: cytokine activity; growth factor activity; transforming growth factor beta receptor binding

Biological Process: BMP signaling pathway; cartilage development; growth; male genitalia development; negative regulation of aldosterone biosynthetic process; negative regulation of cell proliferation; negative regulation of insulin-like growth factor receptor signaling pathway; ossification; pattern specification process; positive regulation of epithelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; regulation of apoptosis; regulation of MAPKKK cascade; skeletal development
Show more

Research Articles on BMP5

1. findings suggested that BMP5 might be a potential prognostic biomarker or therapeutic target for patients with NSCLC

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-BMP5 antibody

 Products by Pathway  Pathway Diagram
 BMP Signaling Pathway antibodies  BMP Signaling Pathway Diagram
 BMP Signaling Pathway antibodies  BMP Signaling Pathway Diagram
 Hippo Signaling Pathway antibodies  Hippo Signaling Pathway Diagram
 Hippo Signaling Pathway antibodies  Hippo Signaling Pathway Diagram
 TGF-beta Signaling Pathway antibodies  TGF-beta Signaling Pathway Diagram
 TGF-beta Signaling Pathway antibodies  TGF-beta Signaling Pathway Diagram

Diseases associated with anti-BMP5 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >8 publications with BMP5 and Inflammation
 Abnormalities, Multiple Antibodies  >6 publications with BMP5 and Abnormalities, Multiple
 Carcinoma Antibodies  >6 publications with BMP5 and Carcinoma
 Nervous System Diseases Antibodies  >5 publications with BMP5 and Nervous System Diseases
 Fibrosis Antibodies  >4 publications with BMP5 and Fibrosis
 Necrosis Antibodies  >3 publications with BMP5 and Necrosis
 Breast Neoplasms Antibodies  >2 publications with BMP5 and Breast Neoplasms
 Kidney Diseases Antibodies  >2 publications with BMP5 and Kidney Diseases
 Adenocarcinoma Antibodies  >2 publications with BMP5 and Adenocarcinoma
 Cell Transformation, Neoplastic Antibodies  >2 publications with BMP5 and Cell Transformation, Neoplastic

Organs/Tissues associated with anti-BMP5 antibody

 Organ/Tissue Name  Pubmed Publications
 Embryonic Tissue Antibodies  >24 publications with BMP5 and Embryonic Tissue
 Connective Tissue Antibodies  >17 publications with BMP5 and Connective Tissue
 Muscle Antibodies  >14 publications with BMP5 and Muscle
 Brain Antibodies  >9 publications with BMP5 and Brain
 Heart Antibodies  >8 publications with BMP5 and Heart
 Lung Antibodies  >6 publications with BMP5 and Lung
 Eye Antibodies  >5 publications with BMP5 and Eye
 Prostate Antibodies  >5 publications with BMP5 and Prostate
 Liver Antibodies  >4 publications with BMP5 and Liver
 Placenta Antibodies  >4 publications with BMP5 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000