Rabbit Anti-MUC3A/MUC3B Polyclonal Antibody – Cat# MBS178455

Western blot analysis of MUC3 expression in SW620 whole cell lysates (lane 1) and COLO320 whole cell lysates (lane 2). MUC3 at 266KD was detected using rabbit anti-MUC3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

MUC3A/MUC3B Antibody – Rabbit Polyclonal

Name: MUC3A/MUC3B Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178455
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178455

Rabbit IgG polyclonal antibody for Mucin-3A/Mucin-3B (MUC3A/MUC3B) detection. Background: MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MUC3A/MUC3B, Polyclonal Antibody

Full Product Name

Anti-MUC3 Antibody

Product Gene Name

anti-MUC3A/MUC3B antibody

Product Synonym Names

MUC-3A; MUC3A; MUC 3A; Mucin 3A; MUC-3B; MUC3B; MUC 3B; MUC3; Mucin 3; Q02505; Q9H195; Mucin-3A/Mucin-3B; mucin 3A, cell surface associated/mucin 3B, cell surface associated

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human
No cross reactivity with other proteins.

Form/Format

Lyophilized

Purity/Purification

Immunogen affinity purified.

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

338,839 Da

OMIM

158371

3D Structure

ModBase 3D Structure for Q02505

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK).

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-MUC3A/MUC3B antibody

Western Blot (WB)

Application Notes for anti-MUC3A/MUC3B antibody

Western Blot: 0.1-0.5mug/ml; Tested Species: Human
Tested Species:In-house tested species with positive results.
Other applications have not been tested.

Product References and Citations for anti-MUC3A/MUC3B antibody

1. Fox, M., Lahbib, F., Pratt, W., Attwood, J., Gum, J., Kim, Y., Swallow, D. M. Regional localisation of MUC3 to chromosome 7q22. (Abstract) Cytogenet. Cell Genet. 58: 1920-1921, 1991.
2. Pan, Q., Tian, Y., Li, X., Ye, J., Liu, Y., Song, L., Yang, Y., Zhu, R., He, Y., Chen, L., Chen, W., Mao, X., Peng, Z., Wang, R. Enhanced membrane-tethered mucin 3 (MUC3) expression by a tetrameric branched peptide with a conserved TFLK motif inhibits bacteria adherence. J. Biol. Chem. 288: 5407-5416, 2013.
3. Williams, S. J., Munster, D. J., Quin, R. J., Gotley, D. C., McGuckin, M. A. The MUC3 gene encodes a transmembrane mucin and is alternatively spliced. Biochem. Biophys. Res. Commun. 261: 83-89, 1999.

Other Notes

Small volumes of anti-MUC3A/MUC3B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MUC3A/MUC3B purchase

MBS178455 is an antibody targeting MUC3A/MUC3B. Also known as Anti-MUC3 Antibody. Reactive in Human
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MUC3A/MUC3B. It may not necessarily be applicable to this product.

NCBI GI #

628601833

NCBI GeneID

4584

NCBI Accession #

NP_005951.1

UniProt Primary Accession #

Q02505

UniProt Secondary Accession #

O14650; O14651; O43418; O43421; Q02506; Q6W763; Q9H3Q7; Q9UKW9; Q9UN93; Q9UN94; A6NP22

UniProt Related Accession #

Q02505

GenBank Nucleotide #

NM_005960.1

NCBI Official Full Name

mucin-3A

NCBI Official Synonym Full Names

mucin 3A, cell surface associated

NCBI Official Symbol

MUC3A

NCBI Official Synonym Symbols

MUC3; MUC-3A

UniProt Protein Name

Mucin-3A

UniProt Synonym Protein Names

Intestinal mucin-3A

UniProt Gene Name

MUC3A

UniProt Synonym Gene Names

MUC-3ACurated

UniProt Entry Name

MUC3A_HUMAN

NCBI Protein Information

mucin-3A

NCBI Summary for MUC3A/MUC3B

The mucin genes encode epithelial glycoproteins, some of which are secreted and some membrane bound. Each of the genes contains at least one large domain of tandemly repeated sequence that encodes the peptide sequence rich in serine and/or threonine residues, which carries most of the O-linked glycosylation (Gendler and Spicer, 1995 [PubMed 7778880]).[supplied by OMIM, Aug 2008]

UniProt Comments for MUC3A/MUC3B

MUC3A: Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. May be involved in ligand binding and intracellular signaling. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: Golgi lumen

Biological Process: O-glycan processing

Disease: Inflammatory Bowel Disease 11

Research Articles on MUC3A/MUC3B

1. DNA hypomethylation in the 5'-flanking region of the MUC3A gene plays an important role in MUC3A expression in carcinomas of various organs.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MUC3A/MUC3B antibody

Products by Pathway	Pathway Diagram
Defective C1GALT1C1 Causes Tn Polyagglutination Syndrome (TNPS) Pathway antibodies	Defective C1GALT1C1 Causes Tn Polyagglutination Syndrome (TNPS) Pathway Diagram
Defective GALNT12 Causes Colorectal Cancer 1 (CRCS1) Pathway antibodies	Defective GALNT12 Causes Colorectal Cancer 1 (CRCS1) Pathway Diagram
Defective GALNT3 Causes Familial Hyperphosphatemic Tumoral Calcinosis (HFTC) Pathway antibodies	Defective GALNT3 Causes Familial Hyperphosphatemic Tumoral Calcinosis (HFTC) Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Diseases Associated With O-glycosylation Of Proteins Pathway antibodies	Diseases Associated With O-glycosylation Of Proteins Pathway Diagram
Diseases Of Glycosylation Pathway antibodies	Diseases Of Glycosylation Pathway Diagram
Metabolism Of Proteins Pathway antibodies	Metabolism Of Proteins Pathway Diagram
O-linked Glycosylation Pathway antibodies	O-linked Glycosylation Pathway Diagram
O-linked Glycosylation Of Mucins Pathway antibodies	O-linked Glycosylation Of Mucins Pathway Diagram
Post-translational Protein Modification Pathway antibodies	Post-translational Protein Modification Pathway Diagram

Organs/Tissues associated with anti-MUC3A/MUC3B antibody

Organ/Tissue Name	Pubmed Publications
Intestine Antibodies	>11 publications with MUC3A/MUC3B and Intestine
Lung Antibodies	>3 publications with MUC3A/MUC3B and Lung
Stomach Antibodies	>2 publications with MUC3A/MUC3B and Stomach
Thyroid Antibodies	>1 publications with MUC3A/MUC3B and Thyroid