• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ABCB10 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178471

Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial (ABCB10) detection. Background: ABCB10, also known as M-ABC2, is expressed as a 60-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ABCB10, Polyclonal Antibody
Full Product Name
Anti-ABCB10 Antibody
Product Gene Name
anti-ABCB10 antibody
Product Synonym Names
ABC transporter 10 protein; ABCB10; EST20237; M ABC2; M-ABC2; MTABC2; Q9NRK6; ATP-binding cassette sub-family B member 10, mitochondrial; ATP binding cassette subfamily B member 10
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
79,148 Da
OMIM
605454
3D Structure
ModBase 3D Structure for Q9NRK6
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-ABCB10 antibody
Western Blot (WB)
Application Notes for anti-ABCB10 antibody
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.

Western Blot (WB) of anti-ABCB10 antibody

Western blot analysis of ABCB10 expression in rat cardiac muscle extract (lane 1), COLO320 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and PANC whole cell lysates (lane 4). ABCB10 at 79KD, 65KD was detected using rabbit anti- ABCB10 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-ABCB10 Polyclonal Antibody – Cat# MBS178471

Product References and Citations for anti-ABCB10 antibody

1. Allikmets, R., Gerrard, B., Glavac, D., Ravnik-Glavac, M., Jenkins, N. A., Gilbert, D. J., Copeland, N. G., Modi, W., Dean, M.Characterization and mapping of three new mammalian ATP-binding transporter genes from an EST database. Mammalian Genome 6: 114-117, 1995.
2. Chen, W., Paradkar, P. N., Li, L., Pierce, E. L., Langer, N. B., Takahashi-Makise, N., Hyde, B. B., Shirihai, O. S., Ward, D. M., Kaplan, J., Paw, B. H. Abcb10 physically interacts with mitoferrin-1 (Slc25a37) to enhance its stability and function in the erythroid mitochondria. Proc. Nat. Acad. Sci. 106: 16263-16268, 2009.
3. Zhang, F., Hogue, D. L., Liu, L., Fisher, C. L., Hui, D., Childs, S., Ling, V. M-ABC2, a new human mitochondrial ATP-binding cassette membrane protein. FEBS Lett. 478: 89-94, 2000.

Other Notes

Small volumes of anti-ABCB10 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ABCB10 purchase

MBS178471 is an antibody targeting ABCB10. Reactive in Human, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for ABCB10. It may not necessarily be applicable to this product.

NCBI GI #
171184400
NCBI GeneID
23456
NCBI Accession #
NP_036221.2
UniProt Primary Accession #
Q9NRK6
UniProt Secondary Accession #
Q13040; Q6P1Q8; Q9H3V0
UniProt Related Accession #
Q9NRK6
GenBank Nucleotide #
NM_012089.2
NCBI Official Full Name
ATP-binding cassette sub-family B member 10, mitochondrial
NCBI Official Synonym Full Names
ATP binding cassette subfamily B member 10
NCBI Official Symbol
ABCB10
NCBI Official Synonym Symbols
M-ABC2; MTABC2; EST20237
UniProt Protein Name
ATP-binding cassette sub-family B member 10, mitochondrial
UniProt Synonym Protein Names
ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2
Protein Family
ABC transporter B family
UniProt Gene Name
ABCB10
UniProt Synonym Gene Names
ABC transporter 10 protein; M-ABC2
UniProt Entry Name
ABCBA_HUMAN
NCBI Protein Information
ATP-binding cassette sub-family B member 10, mitochondrial

NCBI Summary for ABCB10

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for ABCB10

ABCB10: May mediate critical mitochondrial transport functions related to heme biosynthesis. Belongs to the ABC transporter superfamily. ABCB family. Mitochondrial peptide exporter (TC 3.A.1.212) subfamily.

Protein type: Transporter; Membrane protein, multi-pass; Mitochondrial; Membrane protein, integral; Hydrolase; Transporter, ABC family

Chromosomal Location of Human Ortholog: 1q42.13

Molecular Function: ATPase activity, coupled to transmembrane movement of substances

Biological Process: transmembrane transport
Show more

Research Articles on ABCB10

1. ABCB10 is required for primitive erythropoiesis and to protect from oxidative stress associated with cardiac ischemia-reperfusion in mice. Antioxidants can rescue the defects associated with ABCB10 loss-of-function in mice.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ABCB10 antibody

 Reference Product  PubMed Publications
 SLC25A37 antibody  >2 publications with ABCB10 and SLC25A37
 BAK1 antibody  >1 publications with ABCB10 and BAK1

Pathways associated with anti-ABCB10 antibody

 Products by Pathway  Pathway Diagram
 ABC Transporters Pathway antibodies  ABC Transporters Pathway Diagram
 ABC Transporters Pathway antibodies  ABC Transporters Pathway Diagram
 ABC-family Proteins Mediated Transport Pathway antibodies  ABC-family Proteins Mediated Transport Pathway Diagram
 Mitochondrial ABC Transporters Pathway antibodies  Mitochondrial ABC Transporters Pathway Diagram
 Transmembrane Transport Of Small Molecules Pathway antibodies  Transmembrane Transport Of Small Molecules Pathway Diagram

Diseases associated with anti-ABCB10 antibody

 Disease Name  Pubmed Publications
 Adenocarcinoma Antibodies  >2 publications with ABCB10 and Adenocarcinoma
 Anemia Antibodies  >2 publications with ABCB10 and Anemia
 Liver Neoplasms Antibodies  >1 publications with ABCB10 and Liver Neoplasms
 Heart Diseases Antibodies  >1 publications with ABCB10 and Heart Diseases
 Liver Diseases Antibodies  >1 publications with ABCB10 and Liver Diseases
 Carcinoma, Hepatocellular Antibodies  >1 publications with ABCB10 and Carcinoma, Hepatocellular
 Neoplasms, Experimental Antibodies  >1 publications with ABCB10 and Neoplasms, Experimental
 Drug-Induced Liver Injury Antibodies  >1 publications with ABCB10 and Drug-Induced Liver Injury

Organs/Tissues associated with anti-ABCB10 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >9 publications with ABCB10 and Blood
 Liver Antibodies  >3 publications with ABCB10 and Liver
 Bone Marrow Antibodies  >2 publications with ABCB10 and Bone Marrow
 Bone Antibodies  >2 publications with ABCB10 and Bone
 Brain Antibodies  >2 publications with ABCB10 and Brain
 Muscle Antibodies  >2 publications with ABCB10 and Muscle
 Intestine Antibodies  >1 publications with ABCB10 and Intestine
 Embryonic Tissue Antibodies  >1 publications with ABCB10 and Embryonic Tissue
 Skin Antibodies  >1 publications with ABCB10 and Skin
 Uncharacterized Tissue Antibodies  >1 publications with ABCB10 and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000