• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DDAH2 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178501

Rabbit IgG polyclonal antibody for N (G),N (G)-dimethylarginine dimethylaminohydrolase 2 (DDAH2) detection. Background: DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DDAH2, Polyclonal Antibody
Full Product Name
Anti-DDAH2 Antibody
Product Gene Name
anti-DDAH2 antibody
Product Synonym Names
DDAH; DDAH II; DDAHII; DDAH2; DDAH-2; DDAH 2; Dimethylargininase 2; Dimethylargininase-2; G6a; NG30; Protein G6a; S phase protein; S-phase protein; O95865; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; dimethylarginine dimethylaminohydrolase 2
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
29,644 Da
OMIM
604744
3D Structure
ModBase 3D Structure for O95865
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-DDAH2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-DDAH2 antibody
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat
Immunohistochemisry Paraffin: 0.5-1mug/ml; Tested Species: Human
Tested Species:In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.

Western Blot (WB) of anti-DDAH2 antibody

Western blot analysis of DDAH2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and human placenta extract (lane 3). DDAH2 at 27KD was detected using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-DDAH2 Polyclonal Antibody – Cat# MBS178501

Immunohistochemistry (IHC) of anti-DDAH2 antibody

DDAH2 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-DDAH2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178501

Immunohistochemistry (IHC) of anti-DDAH2 antibody

DDAH2 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- DDAH2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-DDAH2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178501

Product References and Citations for anti-DDAH2 antibody

1. Leiper, J. M,, Santa Maria, J., Chubb, A., MacAllister, R. J., Charles, I. G., Whitley, G. S., Vallance, P. Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases.Biochem. J. 343: 209-214, 1999.
2. Smith, C. L., Birdsey, G. M., Anthony, S., Arrigoni, F. I., Leiper, J. M., Vallance, P. Dimethylarginine dimethylaminohydrolase activity modulates ADMA levels, VEGF expression, and cell phenotype. Biochem. Biophys. Res. Commun. 308: 984-989, 2003.
3. Tran, C. T. L., Fox, M. F., Vallance, P., Leiper, J. M. Chromosomal localization, gene structure, and expression pattern of DDAH1: comparison with DDAH2 and implications for evolutionary origins. Genomics 68: 101-105, 2000.

Other Notes

Small volumes of anti-DDAH2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DDAH2 purchase

MBS178501 is an antibody targeting DDAH2. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for DDAH2. It may not necessarily be applicable to this product.

NCBI GI #
731441424
NCBI GeneID
23564
NCBI Accession #
NP_001289936.1
UniProt Primary Accession #
O95865
UniProt Secondary Accession #
A2BEZ7
UniProt Related Accession #
O95865
GenBank Nucleotide #
NM_001303007.1
NCBI Official Full Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
NCBI Official Synonym Full Names
dimethylarginine dimethylaminohydrolase 2
NCBI Official Symbol
DDAH2
NCBI Official Synonym Symbols
G6a; DDAH; NG30; DDAHII; HEL-S-277
UniProt Protein Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
UniProt Synonym Protein Names
DDAHII; Dimethylargininase-2; Protein G6a; S-phase protein
Protein Family
N(G),N(G)-dimethylarginine dimethylaminohydrolase
UniProt Gene Name
DDAH2
UniProt Synonym Gene Names
DDAH; G6A; NG30; DDAH-2; Dimethylarginine dimethylaminohydrolase 2
UniProt Entry Name
DDAH2_HUMAN
NCBI Protein Information
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

NCBI Summary for DDAH2

This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants. [provided by RefSeq, Dec 2014]
Show more

UniProt Comments for DDAH2

DDAH2: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. Belongs to the DDAH family.

Protein type: Apoptosis; Hydrolase; EC 3.5.3.18

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: centrosome; cytoplasm; cytosol

Molecular Function: catalytic activity; dimethylargininase activity; protein binding

Biological Process: citrulline metabolic process; negative regulation of apoptosis; nitric oxide biosynthetic process; nitric oxide mediated signal transduction; positive regulation of nitric oxide biosynthetic process; regulation of nitric-oxide synthase activity
Show more

Research Articles on DDAH2

1. Inhibiting the expression of DDAH1, but not DDAH2, resulted in a significant increase in the sensitivity of the EVT cell line SGHPL-4 to tumour necrosis factor related apoptosis inducing ligand (TRAIL) induced apoptosis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-DDAH2 antibody

 Products by Pathway  Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Nitric Oxide Pathway antibodies  Metabolism Of Nitric Oxide Pathway Diagram
 ENOS Activation Pathway antibodies  ENOS Activation Pathway Diagram
 ENOS Activation And Regulation Pathway antibodies  ENOS Activation And Regulation Pathway Diagram

Diseases associated with anti-DDAH2 antibody

 Disease Name  Pubmed Publications
 Hypertension Antibodies  >20 publications with DDAH2 and Hypertension
 Atherosclerosis Antibodies  >15 publications with DDAH2 and Atherosclerosis
 Heart Diseases Antibodies  >14 publications with DDAH2 and Heart Diseases
 Inflammation Antibodies  >7 publications with DDAH2 and Inflammation
 Kidney Diseases Antibodies  >5 publications with DDAH2 and Kidney Diseases
 Hypertrophy Antibodies  >5 publications with DDAH2 and Hypertrophy
 Necrosis Antibodies  >4 publications with DDAH2 and Necrosis
 Brain Diseases Antibodies  >4 publications with DDAH2 and Brain Diseases
 Hemorrhage Antibodies  >3 publications with DDAH2 and Hemorrhage
 Fibrosis Antibodies  >3 publications with DDAH2 and Fibrosis

Organs/Tissues associated with anti-DDAH2 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >49 publications with DDAH2 and Blood
 Vascular Antibodies  >43 publications with DDAH2 and Vascular
 Heart Antibodies  >18 publications with DDAH2 and Heart
 Kidney Antibodies  >14 publications with DDAH2 and Kidney
 Lung Antibodies  >12 publications with DDAH2 and Lung
 Muscle Antibodies  >10 publications with DDAH2 and Muscle
 Embryonic Tissue Antibodies  >7 publications with DDAH2 and Embryonic Tissue
 Brain Antibodies  >7 publications with DDAH2 and Brain
 Liver Antibodies  >6 publications with DDAH2 and Liver
 Placenta Antibodies  >3 publications with DDAH2 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000