• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Peptide Yy (PYY) Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178514

Rabbit IgG polyclonal antibody for Peptide YY (PYY) detection. Background: Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Peptide YY (PYY), Polyclonal Antibody
Full Product Name
Anti-Peptide YY Antibody
Product Gene Name
anti-PYY antibody
Product Synonym Names
GHYY; peptide YY; PYY 1; PYY I; PYYI; PYY; PYY II; PYY-II; RATGHYY; Yy; Q9EPS2; Peptide YY
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Mouse
No cross reactivity with other proteins.
Form/Format
Lyophilized
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
11,064 Da
3D Structure
ModBase 3D Structure for Q9EPS2
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-PYY antibody
Western Blot (WB)
Application Notes for anti-PYY antibody
Western Blot: 0.1-0.5mug/ml; Tested Species: Mouse
Tested Species:In-house tested species with positive results.
Other applications have not been tested.

Western Blot (WB) of anti-PYY antibody

Western blot analysis of Peptide YY expression in mouse spleen extract (lane 1) and mouse liver extract (lane 2). Peptide YY at 19KD was detected using rabbit anti- Peptide YY Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-PYY Polyclonal Antibody – Cat# MBS178514

Product References and Citations for anti-PYY antibody

1. Liu C, Aloia T, Adrian T, Newton T, Bilchik A, Zinner M, Ashley S, McFadden D (1996). "Peptide YY: a potential proabsorptive hormone for the treatment of malabsorptive disorders". Am Surg 62 (3): 232-6.
2. Taylor IL (March 1985). "Distribution and release of peptide YY in dog measured by specific radioimmunoassay". Gastroenterology 88 (3): 731-7.

Other Notes

Small volumes of anti-PYY antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PYY purchase

MBS178514 is an antibody targeting PYY. Also known as Anti-Peptide YY Antibody. Reactive in Mouse
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PYY. It may not necessarily be applicable to this product.

NCBI GI #
21703868
NCBI GeneID
217212
NCBI Accession #
NP_663410.1
UniProt Primary Accession #
Q9EPS2
UniProt Secondary Accession #
Q91XD0
UniProt Related Accession #
Q9EPS2
GenBank Nucleotide #
NM_145435.1
NCBI Official Full Name
peptide YY
NCBI Official Synonym Full Names
peptide YY
NCBI Official Symbol
Pyy
UniProt Protein Name
Peptide YY
UniProt Synonym Protein Names
PYY-II
Protein Family
Peptide
UniProt Gene Name
Pyy
UniProt Synonym Gene Names
PYY
UniProt Entry Name
PYY_MOUSE
NCBI Protein Information
peptide YY

UniProt Comments for PYY

PYY: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. Belongs to the NPY family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular space

Molecular Function: G-protein-coupled receptor binding; neuropeptide hormone activity

Biological Process: cell-cell signaling; digestion; eating behavior; negative regulation of response to food; neuropeptide signaling pathway; regulation of appetite
Show more

Research Articles on PYY

1. Data (including data from studies in transgenic mice) suggest neurotensin (Nts), glucagon-like peptide I (GLP-1), and peptide YY (Pyy) are closely co-expressed and co-secreted within enteroendocrine cells in ileum mucosa.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PYY antibody

 Reference Product  PubMed Publications
 Pomc antibody  >52 publications with PYY and Pomc
 Ppy antibody  >22 publications with PYY and Ppy
 Sst antibody  >9 publications with PYY and Sst
 Npy2r antibody  >6 publications with PYY and Npy2r
 Npy1r antibody  >5 publications with PYY and Npy1r
 Gal antibody  >3 publications with PYY and Gal
 Ccl28 antibody  >2 publications with PYY and Ccl28
 Npy5r antibody  >1 publications with PYY and Npy5r

Pathways associated with anti-PYY antibody

 Products by Pathway  Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 G Alpha (i) Signalling Events Pathway antibodies  G Alpha (i) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 Peptide Ligand-binding Receptors Pathway antibodies  Peptide Ligand-binding Receptors Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By GPCR Pathway antibodies  Signaling By GPCR Pathway Diagram

Diseases associated with anti-PYY antibody

 Disease Name  Pubmed Publications
 Obesity Antibodies  >491 publications with PYY and Obesity
 Weight Loss Antibodies  >200 publications with PYY and Weight Loss
 Weight Gain Antibodies  >102 publications with PYY and Weight Gain
 Insulin Resistance Antibodies  >89 publications with PYY and Insulin Resistance
 Diabetes Mellitus, Type 2 Antibodies  >76 publications with PYY and Diabetes Mellitus, Type 2
 Anorexia Antibodies  >69 publications with PYY and Anorexia
 Hyperinsulinism Antibodies  >60 publications with PYY and Hyperinsulinism
 Inflammation Antibodies  >54 publications with PYY and Inflammation
 Carcinoma Antibodies  >46 publications with PYY and Carcinoma
 Diarrhea Antibodies  >40 publications with PYY and Diarrhea

Organs/Tissues associated with anti-PYY antibody

 Organ/Tissue Name  Pubmed Publications
 Intestine Antibodies  >544 publications with PYY and Intestine
 Pancreas Antibodies  >175 publications with PYY and Pancreas
 Mixed Antibodies  >89 publications with PYY and Mixed
 Embryonic Tissue Antibodies  >16 publications with PYY and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000