Rabbit Anti-NANOG Polyclonal Antibody – Cat# MBS178590

Western blot analysis of Nanog expression in rat ovary extract (lane 1), mouse ovary extract (lane 2) and MCF-7 whole cell lysates (lane 3). Nanog at 48KD was detected using rabbit anti- Nanog Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

NANOG Antibody – Rabbit Polyclonal

Name: NANOG Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178590
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178590

Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection.Background: NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Nanog, Polyclonal Antibody

Full Product Name

Anti-Nanog Antibody

Product Gene Name

anti-NANOG antibody

Product Synonym Names

ENK; NANOG; Q9H9S0; Homeobox protein NANOG; Nanog homeobox

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen affinity purified.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

32,838 Da

OMIM

AB093576 mRNA

3D Structure

ModBase 3D Structure for Q9H9S0

Notes

Tested Species: In-house tested species with positive results.
Other applications have not been tested.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-NANOG antibody

Western Blot (WB)

Application Notes for anti-NANOG antibody

Western Blot: 0.1-0.5ug/ml

Product References and Citations for anti-NANOG antibody

1. Chambers, I., Colby, D., Robertson, M., Nichols, J., Lee, S., Tweedie, S., Smith, A. Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells. Cell 113: 643-655, 2003.
2. Clark, A. T., Rodriguez, R. T., Bodnar, M. S., Abeyta, M. J., Cedars, M. I., Turek, P. J., Firpo, M. T., Pera, R. A. R. Human STELLAR, NANOG, and GDF3 genes are expressed in pluripotent cells and map to chromosome 12p13, a hotspot for teratocarcinoma. Stem Cells 22: 169-179, 2004.
3. Hart, A. H., Hartley, L., Ibrahim, M., Robb, L. Identification, cloning and expression analysis of the pluripotency promotingNanog genes in mouse and human. Dev. Dyn. 230: 187-198, 2004.

Other Notes

Small volumes of anti-NANOG antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NANOG purchase

MBS178590 is an antibody targeting NANOG. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for NANOG. It may not necessarily be applicable to this product.

NCBI GI #

663071050

NCBI GeneID

79923

NCBI Accession #

NP_001284627.1

UniProt Primary Accession #

Q9H9S0

UniProt Secondary Accession #

Q2TTG0; Q6JZS5; D3DUU4

UniProt Related Accession #

Q9H9S0

GenBank Nucleotide #

NM_001297698.1

NCBI Official Full Name

homeobox protein NANOG isoform 2

NCBI Official Synonym Full Names

Nanog homeobox

NCBI Official Symbol

NANOG

UniProt Protein Name

Homeobox protein NANOG

UniProt Synonym Protein Names

Homeobox transcription factor Nanog; hNanog

Protein Family

Homeobox protein

UniProt Gene Name

NANOG

UniProt Synonym Gene Names

hNanog

NCBI Protein Information

homeobox protein NANOG

NCBI Summary for NANOG

The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

UniProt Comments for NANOG

NANOG: Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. When overexpressed, promotes cells to enter into S phase and proliferation. Interacts with SMAD1 and SALL4. Expressed in testicular carcinoma and derived germ cell tumors. Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. Belongs to the Nanog homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: nucleolus; nucleoplasm; nucleus

Molecular Function: DNA binding; protein binding; transcription corepressor activity; transcription factor activity

Biological Process: cell differentiation; cell proliferation; endodermal cell fate specification; positive regulation of transcription from RNA polymerase II promoter; regulation of cell differentiation; regulation of gene expression; regulation of transcription, DNA-dependent; somatic stem cell maintenance; stem cell maintenance

Research Articles on NANOG

1. miR-760 was proved to be functional associated with NANOG via regulating its expression.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NANOG antibody

Reference Product	PubMed Publications
SOX2 antibody	>1784 publications with NANOG and SOX2
POU5F1 antibody	>910 publications with NANOG and POU5F1
KLF4 antibody	>488 publications with NANOG and KLF4
STAT3 antibody	>187 publications with NANOG and STAT3
FGF2 antibody	>71 publications with NANOG and FGF2
SALL4 antibody	>64 publications with NANOG and SALL4
ESRRB antibody	>49 publications with NANOG and ESRRB
FOXD3 antibody	>42 publications with NANOG and FOXD3
LIN28A antibody	>15 publications with NANOG and LIN28A
ZIC3 antibody	>6 publications with NANOG and ZIC3

Pathways associated with anti-NANOG antibody

Products by Pathway	Pathway Diagram
Cardiac Progenitor Differentiation Pathway antibodies	Cardiac Progenitor Differentiation Pathway Diagram
Cytokine Signaling In Immune System Pathway antibodies	Cytokine Signaling In Immune System Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
Endoderm Differentiation Pathway antibodies	Endoderm Differentiation Pathway Diagram
Immune System Pathway antibodies	Immune System Pathway Diagram
Interleukin-4 And 13 Signaling Pathway antibodies	Interleukin-4 And 13 Signaling Pathway Diagram
Mesodermal Commitment Pathway antibodies	Mesodermal Commitment Pathway Diagram
POU5F1 (OCT4), SOX2, NANOG Activate Genes Related To Proliferation Pathway antibodies	POU5F1 (OCT4), SOX2, NANOG Activate Genes Related To Proliferation Pathway Diagram
POU5F1 (OCT4), SOX2, NANOG Repress Genes Related To Differentiation Pathway antibodies	POU5F1 (OCT4), SOX2, NANOG Repress Genes Related To Differentiation Pathway Diagram
Preimplantation Embryo Pathway antibodies	Preimplantation Embryo Pathway Diagram

Diseases associated with anti-NANOG antibody

Disease Name	Pubmed Publications
Neoplasms, Germ Cell and Embryonal Antibodies	>314 publications with NANOG and Neoplasms, Germ Cell and Embryonal
Breast Neoplasms Antibodies	>110 publications with NANOG and Breast Neoplasms
Neoplasm Metastasis Antibodies	>97 publications with NANOG and Neoplasm Metastasis
Disease Models, Animal Antibodies	>95 publications with NANOG and Disease Models, Animal
Carcinoma, Squamous Cell Antibodies	>88 publications with NANOG and Carcinoma, Squamous Cell
Lung Neoplasms Antibodies	>79 publications with NANOG and Lung Neoplasms
Neoplasms, Experimental Antibodies	>77 publications with NANOG and Neoplasms, Experimental
Carcinoma, Hepatocellular Antibodies	>75 publications with NANOG and Carcinoma, Hepatocellular
Liver Diseases Antibodies	>73 publications with NANOG and Liver Diseases
Lung Diseases Antibodies	>72 publications with NANOG and Lung Diseases

Organs/Tissues associated with anti-NANOG antibody

Organ/Tissue Name	Pubmed Publications
Embryonic Tissue Antibodies	>681 publications with NANOG and Embryonic Tissue
Blood Antibodies	>229 publications with NANOG and Blood
Testis Antibodies	>115 publications with NANOG and Testis
Epididymis Antibodies	>2 publications with NANOG and Epididymis