• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

AIF1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178646

Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection.Background: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene.… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Iba1 (AIF1), Polyclonal Antibody
Full Product Name
Anti-Iba1 Antibody
Product Gene Name
anti-AIF1 antibody
Product Synonym Names
AIF 1; AIF-1; AIF1 protein; allograft inflammatory factor 1; G1; IBA1; IBA 1; Iba1; P55008; Allograft inflammatory factor 1
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
14,617 Da
OMIM
U49392 mRNA
3D Structure
ModBase 3D Structure for P55008
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-AIF1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-AIF1 antibody
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml

Western Blot (WB) of anti-AIF1 antibody

Western blot analysis of Iba1 expression in human blood extract (lane 1). Iba1 at 17KD was detected using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-AIF1 Polyclonal Antibody – Cat# MBS178646

Immunohistochemistry (IHC) of anti-AIF1 antibody

Iba1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-AIF1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178646

Immunohistochemistry (IHC) of anti-AIF1 antibody

Iba1 was detected in paraffin-embedded sections of human Appendicitis tissues using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-AIF1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178646

Product References and Citations for anti-AIF1 antibody

1. "Entrez Gene: AIF1 allograft inflammatory factor 1".
2. Utans U, Arceci RJ, Yamashita Y, Russell ME (June 1995). "Cloning and characterization of allograft inflammatory factor-1: a novel macrophage factor identified in rat cardiac allografts with chronic rejection". J. Clin. Invest. 95 (6): 2954-62.
3. Tian Y, Jain S, Kelemen SE, Autieri MV (February 2009). "AIF-1 expression regulates endothelial cell activation, signal transduction, and vasculogenesis". Am. J. Physiol., Cell Physiol. 296 (2): C256-66.

Other Notes

Small volumes of anti-AIF1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AIF1 purchase

MBS178646 is an antibody targeting AIF1. Also known as Anti-Iba1 Antibody. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for AIF1. It may not necessarily be applicable to this product.

NCBI GI #
974987466
NCBI GeneID
199
NCBI Accession #
NP_001305899.1
UniProt Primary Accession #
P55008
UniProt Secondary Accession #
O43904; Q9UIV4; Q9UKS9; A8K406
UniProt Related Accession #
P55008
GenBank Nucleotide #
NM_001318970.1
NCBI Official Full Name
allograft inflammatory factor 1 isoform 1
NCBI Official Synonym Full Names
allograft inflammatory factor 1
NCBI Official Symbol
AIF1
NCBI Official Synonym Symbols
IBA1; IRT1; AIF-1; IRT-1
UniProt Protein Name
Allograft inflammatory factor 1
UniProt Synonym Protein Names
Ionized calcium-binding adapter molecule 1; Protein G1
Protein Family
Allograft inflammatory factor
UniProt Gene Name
AIF1
UniProt Synonym Gene Names
G1; IBA1; AIF-1
NCBI Protein Information
allograft inflammatory factor 1

NCBI Summary for AIF1

This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]
Show more

UniProt Comments for AIF1

AIF1: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: actin filament; cytoplasm; cytosol; lamellipodium; nucleus; perinuclear region of cytoplasm; phagocytic cup

Molecular Function: actin filament binding; calcium ion binding

Biological Process: actin filament bundle formation; actin filament polymerization; inflammatory response; negative regulation of smooth muscle cell proliferation; phagocytosis, engulfment; positive regulation of smooth muscle cell proliferation; positive regulation of T cell proliferation; Rac protein signal transduction
Show more

Research Articles on AIF1

1. involved in the immunological process underlying rheumatoid arthritis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-AIF1 antibody

 Reference Product  PubMed Publications
 GFAP antibody  >143 publications with AIF1 and GFAP
 CD68 antibody  >66 publications with AIF1 and CD68
 OLIG2 antibody  >13 publications with AIF1 and OLIG2
 DCX antibody  >8 publications with AIF1 and DCX
 MBP antibody  >7 publications with AIF1 and MBP
 TSPO antibody  >5 publications with AIF1 and TSPO
 ITGAM antibody  >5 publications with AIF1 and ITGAM
 RBFOX3 antibody  >2 publications with AIF1 and RBFOX3
 BAG6 antibody  >1 publications with AIF1 and BAG6

Pathways associated with anti-AIF1 antibody

 Products by Pathway  Pathway Diagram
 Spinal Cord Injury Pathway antibodies  Spinal Cord Injury Pathway Diagram

Diseases associated with anti-AIF1 antibody

 Disease Name  Pubmed Publications
 Disease Models, Animal Antibodies  >435 publications with AIF1 and Disease Models, Animal
 Inflammation Antibodies  >250 publications with AIF1 and Inflammation
 Cardiovascular Diseases Antibodies  >145 publications with AIF1 and Cardiovascular Diseases
 Necrosis Antibodies  >130 publications with AIF1 and Necrosis
 Brain Injuries Antibodies  >94 publications with AIF1 and Brain Injuries
 Nerve Degeneration Antibodies  >61 publications with AIF1 and Nerve Degeneration
 Hyperalgesia Antibodies  >52 publications with AIF1 and Hyperalgesia
 Poisoning Antibodies  >34 publications with AIF1 and Poisoning
 Neurotoxicity Syndromes Antibodies  >30 publications with AIF1 and Neurotoxicity Syndromes
 Parkinson Disease Antibodies  >27 publications with AIF1 and Parkinson Disease

Organs/Tissues associated with anti-AIF1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >628 publications with AIF1 and Brain
 Blood Antibodies  >213 publications with AIF1 and Blood
 Vascular Antibodies  >80 publications with AIF1 and Vascular
 Muscle Antibodies  >58 publications with AIF1 and Muscle
 Eye Antibodies  >49 publications with AIF1 and Eye
 Bone Marrow Antibodies  >47 publications with AIF1 and Bone Marrow
 Embryonic Tissue Antibodies  >30 publications with AIF1 and Embryonic Tissue
 Heart Antibodies  >25 publications with AIF1 and Heart
 Liver Antibodies  >23 publications with AIF1 and Liver
 Spleen Antibodies  >21 publications with AIF1 and Spleen
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000