• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GAB1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178657

Rabbit IgG polyclonal antibody for GRB2-associated-binding protein 1(GAB1) detection.Background: GRB2-associated-binding protein 1 is a protein that in humans is encoded by the GAB1 gene. It is mapped to 4q31.21. The protein encoded by this gene is a member… More details

$475 / 0.1 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GAB1, Polyclonal Antibody
Full Product Name
Anti-GAB1 Antibody
Product Gene Name
anti-GAB1 antibody
Product Synonym Names
Gab 1; GAB1; Q13480; GRB2-associated-binding protein 1
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Rat
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
80,005 Da
OMIM
U43885 mRNA
3D Structure
ModBase 3D Structure for Q13480
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GAB1 (72-109aa LTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVR), different from the related mouse sequence by one amino acid.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-GAB1 antibody
Western Blot (WB)
Application Notes for anti-GAB1 antibody
Western Blot: 0.1-0.5ug/ml

Western Blot (WB) of anti-GAB1 antibody

Western blot analysis of GAB1 expression in rat testis extract (lane 1) and K562 whole cell lysates (lane 2). GAB1 at 77KD was detected using rabbit anti- GAB1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-GAB1 Polyclonal Antibody – Cat# MBS178657

Product References and Citations for anti-GAB1 antibody

1. "Entrez Gene: GAB1 GRB2-associated binding protein 1".
2. Holgado-Madruga M, Emlet DR, Moscatello DK, Godwin AK, Wong AJ (April 1996). "A Grb2-associated docking protein in EGF- and insulin-receptor signalling". Nature. 379 (6565): 560-4.
3. Rocchi S, Tartare-Deckert S, Murdaca J, Holgado-Madruga M, Wong AJ, Van Obberghen E (July 1998). "Determination of Gab1 (Grb2-associated binder-1) interaction with insulin receptor-signaling molecules". Mol. Endocrinol. 12 (7): 914-23.

Other Notes

Small volumes of anti-GAB1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GAB1 purchase

MBS178657 is an antibody targeting GAB1. Reactive in Human, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for GAB1. It may not necessarily be applicable to this product.

NCBI GI #
46370073
NCBI GeneID
2549
NCBI Accession #
NP_002030.2
UniProt Primary Accession #
Q13480
UniProt Secondary Accession #
Q4W5G2; Q6P1W2; A8K152
UniProt Related Accession #
Q13480
GenBank Nucleotide #
NM_002039.3
NCBI Official Full Name
GRB2-associated-binding protein 1 isoform b
NCBI Official Synonym Full Names
GRB2 associated binding protein 1
NCBI Official Symbol
GAB1
UniProt Protein Name
GRB2-associated-binding protein 1
UniProt Synonym Protein Names
GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1
Protein Family
GPI transamidase component
UniProt Gene Name
GAB1
NCBI Protein Information
GRB2-associated-binding protein 1

NCBI Summary for GAB1

The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Show more

UniProt Comments for GAB1

GAB1: Adapter protein that plays a role in intracellular signaling cascades triggered by activated receptor-type kinases. Plays a role in FGFR1 signaling. Probably involved in signaling by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR). Interacts with GRB2 and with other SH2-containing proteins. Interacts with phosphorylated LAT2. Interacts with PTPRJ. Identified in a complex containing FRS2, GRB2, GAB1, PIK3R1 and SOS1. Interacts (phosphorylated) with PTPN11. Interacts with HCK. Belongs to the GAB family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4q31.21

Cellular Component: cytosol

Molecular Function: 1-phosphatidylinositol-3-kinase activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding; SH3/SH2 adaptor activity

Biological Process: cell proliferation; epidermal growth factor receptor signaling pathway; insulin receptor signaling pathway; phosphoinositide-mediated signaling; regulation of phosphoinositide 3-kinase cascade
Show more

Research Articles on GAB1

1. These results demonstrate that cardiomyocyte Gab1 is a critical regulator of the compensatory cardiac response to aging and hemodynamic stress.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GAB1 antibody

 Reference Product  PubMed Publications
 GRB2 antibody  >222 publications with GAB1 and GRB2
 MET antibody  >111 publications with GAB1 and MET
 PTPN11 antibody  >76 publications with GAB1 and PTPN11
 EGFR antibody  >72 publications with GAB1 and EGFR
 SOS1 antibody  >16 publications with GAB1 and SOS1
 FRS2 antibody  >12 publications with GAB1 and FRS2
 SHC1 antibody  >11 publications with GAB1 and SHC1
 CRKL antibody  >7 publications with GAB1 and CRKL
 GRAP2 antibody  >2 publications with GAB1 and GRAP2
 PIK3R1 antibody  >1 publications with GAB1 and PIK3R1

Pathways associated with anti-GAB1 antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Alpha 6 Beta 4 Signaling Pathway antibodies  Alpha 6 Beta 4 Signaling Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 BDNF-TrkB Signaling Pathway antibodies  BDNF-TrkB Signaling Pathway Diagram
 Bacterial Invasion Of Epithelial Cells Pathway antibodies  Bacterial Invasion Of Epithelial Cells Pathway Diagram
 Bacterial Invasion Of Epithelial Cells Pathway antibodies  Bacterial Invasion Of Epithelial Cells Pathway Diagram
 Constitutive Signaling By Aberrant PI3K In Cancer Pathway antibodies  Constitutive Signaling By Aberrant PI3K In Cancer Pathway Diagram
 Constitutive Signaling By EGFRvIII Pathway antibodies  Constitutive Signaling By EGFRvIII Pathway Diagram
 Constitutive Signaling By Ligand-Responsive EGFR Cancer Variants Pathway antibodies  Constitutive Signaling By Ligand-Responsive EGFR Cancer Variants Pathway Diagram

Diseases associated with anti-GAB1 antibody

 Disease Name  Pubmed Publications
 Lung Diseases Antibodies  >22 publications with GAB1 and Lung Diseases
 Inflammation Antibodies  >20 publications with GAB1 and Inflammation
 Lung Neoplasms Antibodies  >18 publications with GAB1 and Lung Neoplasms
 Adenocarcinoma Antibodies  >17 publications with GAB1 and Adenocarcinoma
 Breast Neoplasms Antibodies  >17 publications with GAB1 and Breast Neoplasms
 Disease Models, Animal Antibodies  >16 publications with GAB1 and Disease Models, Animal
 Vascular Diseases Antibodies  >14 publications with GAB1 and Vascular Diseases
 Neoplasm Metastasis Antibodies  >11 publications with GAB1 and Neoplasm Metastasis
 Nervous System Diseases Antibodies  >11 publications with GAB1 and Nervous System Diseases
 Liver Diseases Antibodies  >10 publications with GAB1 and Liver Diseases
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000