Rabbit Anti-MC2R Polyclonal Antibody – Cat# MBS178665

Western blot analysis of MC2 receptor expression in mouse brain extract (lane 1). MC2 receptor at 39KD was detected using rabbit anti- MC2 receptor Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

MC2 Receptor (MC2R) Antibody – Rabbit Polyclonal

Name: MC2R Antibody; Polyclonal; Rabbit; Mouse-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178665
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178665

Rabbit IgG polyclonal antibody for Adrenocorticotropic hormone receptor(MC2R) detection.Background: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MC2 Receptor (MC2R), Polyclonal Antibody

Full Product Name

Anti-MC2 Receptor Antibody

Product Gene Name

anti-MC2R antibody

Product Synonym Names

ACTH receptor; ACTH-R; ACTHR; MC2 receptor; MC2-R; MC2R; Q01718; Adrenocorticotropic hormone receptor; melanocortin 2 receptor

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Mouse

Form/Format

Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen affinity purified.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

33,927 Da

OMIM

X65633 Genomic DNA

3D Structure

ModBase 3D Structure for Q01718

Notes

Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-MC2R antibody

Western Blot (WB)

Application Notes for anti-MC2R antibody

Western Blot: 0.1-0.5ug/ml

Product References and Citations for anti-MC2R antibody

1. Chida, D., Nakagawa, S., Nagai, S., Sagara, H., Katsumata, H., Imaki, T., Suzuki, H., Mitani, F., Ogishima, T., Shimizu, C., Kotaki, H., Kakuta, S., Sudo, K., Koike, T., Kubo, M., Iwakura, Y. Melanocortin 2 receptor is required for adrenal gland development, steroidogenesis, and neonatal gluconeogenesis. Proc. Nat. Acad. Sci. 104: 18205-18210, 2007.
2. Naville, D., Jaillard, C., Barjhoux, L., Durand, P., Begeot, M. Genomic structure and promoter characterization of the human ACTH receptor gene. Biochem. Biophys. Res. Commun. 230: 7-12, 1997.
3. Vamvakopoulos, N. C., Rojas, K., Overhauser, J., Durkin, A. S., Nierman, W. C., Chrousos, G. P. Mapping the human melanocortin 2 receptor (adrenocorticotropic hormone receptor; ACTHR) gene (MC2R) to the small arm of chromosome 18 (18p11.21-pter). Genomics 18: 454-455, 1993.

Other Notes

Small volumes of anti-MC2R antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MC2R purchase

MBS178665 is an antibody targeting MC2R. Also known as Anti-MC2 Receptor Antibody. Reactive in Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MC2R. It may not necessarily be applicable to this product.

NCBI GI #

4505127

NCBI GeneID

4158

NCBI Accession #

NP_000520.1

UniProt Primary Accession #

Q01718

UniProt Secondary Accession #

Q3MI45; Q504X6; A8K016

UniProt Related Accession #

Q01718

GenBank Nucleotide #

NM_000529.2

NCBI Official Full Name

adrenocorticotropic hormone receptor

NCBI Official Synonym Full Names

melanocortin 2 receptor

NCBI Official Symbol

MC2R

NCBI Official Synonym Symbols

ACTHR

UniProt Protein Name

Adrenocorticotropic hormone receptor

UniProt Synonym Protein Names

Adrenocorticotropin receptor; Melanocortin receptor 2; MC2-R

Protein Family

Adrenocorticotropic hormone receptor

UniProt Gene Name

MC2R

UniProt Synonym Gene Names

ACTHR; ACTH receptor; ACTH-R; MC2-R

NCBI Protein Information

adrenocorticotropic hormone receptor

NCBI Summary for MC2R

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene. [provided by RefSeq, May 2014]

UniProt Comments for MC2R

MC2R: Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase. Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1); also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 18p11.21

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: melanocortin receptor activity; protein binding

Biological Process: G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; positive regulation of cAMP biosynthetic process

Disease: Glucocorticoid Deficiency 1

Research Articles on MC2R

1. melanocortin receptors MC2R, MC3R and MC5R are most abundantly expressed in glandular epithelium of the endometrium

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MC2R antibody

Reference Product	PubMed Publications
POMC antibody	>146 publications with MC2R and POMC
MRAP antibody	>73 publications with MC2R and MRAP
CRH antibody	>17 publications with MC2R and CRH
FSHR antibody	>2 publications with MC2R and FSHR
AVP antibody	>2 publications with MC2R and AVP
CRHR2 antibody	>2 publications with MC2R and CRHR2
TSHR antibody	>1 publications with MC2R and TSHR
LHCGR antibody	>1 publications with MC2R and LHCGR
GIPR antibody	>1 publications with MC2R and GIPR

Pathways associated with anti-MC2R antibody

Products by Pathway	Pathway Diagram
Aldosterone Synthesis And Secretion Pathway antibodies	Aldosterone Synthesis And Secretion Pathway Diagram
Aldosterone Synthesis And Secretion Pathway antibodies	Aldosterone Synthesis And Secretion Pathway Diagram
Class A/1 (Rhodopsin-like Receptors) Pathway antibodies	Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway antibodies	Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Diseases Of Metabolism Pathway antibodies	Diseases Of Metabolism Pathway Diagram
G Alpha (s) Signalling Events Pathway antibodies	G Alpha (s) Signalling Events Pathway Diagram
GPCR Downstream Signaling Pathway antibodies	GPCR Downstream Signaling Pathway Diagram
GPCR Ligand Binding Pathway antibodies	GPCR Ligand Binding Pathway Diagram
GPCRs, Class A Rhodopsin-like Pathway antibodies	GPCRs, Class A Rhodopsin-like Pathway Diagram

Diseases associated with anti-MC2R antibody

Disease Name	Pubmed Publications
Hyperplasia Antibodies	>17 publications with MC2R and Hyperplasia
Inflammation Antibodies	>6 publications with MC2R and Inflammation
Familial Glucocorticoid Deficiency 1 Antibodies	>5 publications with MC2R and Familial Glucocorticoid Deficiency 1
Hypertension Antibodies	>5 publications with MC2R and Hypertension
Urogenital Abnormalities Antibodies	>4 publications with MC2R and Urogenital Abnormalities
Prenatal Exposure Delayed Effects Antibodies	>3 publications with MC2R and Prenatal Exposure Delayed Effects
Insulin Resistance Antibodies	>3 publications with MC2R and Insulin Resistance
Growth Disorders Antibodies	>3 publications with MC2R and Growth Disorders
Disease Models, Animal Antibodies	>3 publications with MC2R and Disease Models, Animal
Adenocarcinoma Antibodies	>3 publications with MC2R and Adenocarcinoma

Organs/Tissues associated with anti-MC2R antibody

Organ/Tissue Name	Pubmed Publications
Adrenal Gland Antibodies	>87 publications with MC2R and Adrenal Gland
Brain Antibodies	>60 publications with MC2R and Brain