• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GAD65 (GAD2) Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178680

Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection.Background: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GAD65 (GAD2), Polyclonal Antibody
Full Product Name
Anti-GAD65 Antibody
Product Gene Name
anti-GAD2 antibody
Product Synonym Names
4.1.1.15; 65 kDa glutamic acid decarboxylase; DCE 2; DCE2; GAD 2; GAD 65; GAD2; GAD-2; GAD65; GAD-65; Glutamate decarboxylase 2; Glutamate Decarboxylase 65; Q05329; glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
65,411 Da
OMIM
M81882 mRNA
3D Structure
ModBase 3D Structure for Q05329
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-GAD2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-GAD2 antibody
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml

Western Blot (WB) of anti-GAD2 antibody

Western blot analysis of GAD65 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). GAD65 at 65KD was detected using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-GAD2 Polyclonal Antibody – Cat# MBS178680

Immunohistochemistry (IHC) of anti-GAD2 antibody

GAD65 was detected in paraffin-embedded sections of rat kidney tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-GAD2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178680

Immunohistochemistry (IHC) of anti-GAD2 antibody

GAD65 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-GAD2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178680

Immunohistochemistry (IHC) of anti-GAD2 antibody

GAD65 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-GAD2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178680

Product References and Citations for anti-GAD2 antibody

1. "Entrez Gene: GAD2 glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)".
2. Meyre, D., Boutin, P., Tounian, A., Deweirder, M., Aout, M., Jouret, B., Heude, B., Weill, J., Tauber, M., Tounian, P., Froguel, P. Is glutamate decarboxylase 2 (GAD2) a genetic link between low birth weight and subsequent development of obesity in children?J. Clin. Endocr. Metab. 90: 2384-2390, 2005.
3. Zhang, Z., Cai, Y. Q., Zou, F., Bie, B., Pan, Z. Z. Epigenetic suppression of GAD65 expression mediates persistent pain. Nature Med. 17: 1448-1455, 2011.

Other Notes

Small volumes of anti-GAD2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GAD2 purchase

MBS178680 is an antibody targeting GAD2. Also known as Anti-GAD65 Antibody. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for GAD2. It may not necessarily be applicable to this product.

NCBI GI #
4503875
NCBI GeneID
2572
NCBI Accession #
NP_000809.1
UniProt Primary Accession #
Q05329
UniProt Secondary Accession #
Q9UD87
UniProt Related Accession #
Q05329
GenBank Nucleotide #
NM_000818.2
NCBI Official Full Name
glutamate decarboxylase 2
NCBI Official Synonym Full Names
glutamate decarboxylase 2
NCBI Official Symbol
GAD2
NCBI Official Synonym Symbols
GAD65
UniProt Protein Name
Glutamate decarboxylase 2
UniProt Synonym Protein Names
65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform
Protein Family
Glutamate decarboxylase
UniProt Gene Name
GAD2
UniProt Synonym Gene Names
GAD65; GAD-65
NCBI Protein Information
glutamate decarboxylase 2

NCBI Summary for GAD2

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2008]
Show more

UniProt Comments for GAD2

GAD2: Catalyzes the production of GABA. Homodimer. Belongs to the group II decarboxylase family.

Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; Carbohydrate Metabolism - butanoate; EC 4.1.1.15; Lyase; Other Amino Acids Metabolism - beta-alanine; Other Amino Acids Metabolism - taurine and hypotaurine

Chromosomal Location of Human Ortholog: 10p12.1

Cellular Component: plasma membrane

Molecular Function: glutamate decarboxylase activity; protein binding

Biological Process: neurotransmitter secretion; synaptic transmission
Show more

Research Articles on GAD2

1. UV exposed hydrogen peroxide produces hydroxyl radical that may cause protein damage (GAD-65) to the extent of generating neo-epitopes on the molecule, making it immunogenic.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GAD2 antibody

 Reference Product  PubMed Publications
 GLUL antibody  >2 publications with GAD2 and GLUL
 SLC32A1 antibody  >2 publications with GAD2 and SLC32A1
 GLS antibody  >1 publications with GAD2 and GLS
 INS antibody  >1 publications with GAD2 and INS
 ABAT antibody  >1 publications with GAD2 and ABAT

Pathways associated with anti-GAD2 antibody

 Products by Pathway  Pathway Diagram
 Alanine And Aspartate Metabolism Pathway antibodies  Alanine And Aspartate Metabolism Pathway Diagram
 Alanine, Aspartate And Glutamate Metabolism Pathway antibodies  Alanine, Aspartate And Glutamate Metabolism Pathway Diagram
 Alanine, Aspartate And Glutamate Metabolism Pathway antibodies  Alanine, Aspartate And Glutamate Metabolism Pathway Diagram
 Biogenic Amine Synthesis Pathway antibodies  Biogenic Amine Synthesis Pathway Diagram
 Butanoate Metabolism Pathway antibodies  Butanoate Metabolism Pathway Diagram
 Butanoate Metabolism Pathway antibodies  Butanoate Metabolism Pathway Diagram
 GABA (gamma-Aminobutyrate) Shunt Pathway antibodies  GABA (gamma-Aminobutyrate) Shunt Pathway Diagram
 GABA (gamma-Aminobutyrate) Shunt Pathway antibodies  GABA (gamma-Aminobutyrate) Shunt Pathway Diagram
 GABA Synthesis Pathway antibodies  GABA Synthesis Pathway Diagram
 GABA Synthesis, Release, Reuptake And Degradation Pathway antibodies  GABA Synthesis, Release, Reuptake And Degradation Pathway Diagram

Diseases associated with anti-GAD2 antibody

 Disease Name  Pubmed Publications
 Mental Disorders Antibodies  >26 publications with GAD2 and Mental Disorders
 Nervous System Diseases Antibodies  >16 publications with GAD2 and Nervous System Diseases
 Schizophrenia Antibodies  >13 publications with GAD2 and Schizophrenia
 Brain Diseases Antibodies  >13 publications with GAD2 and Brain Diseases
 Anxiety Disorders Antibodies  >6 publications with GAD2 and Anxiety Disorders
 Epilepsy Antibodies  >6 publications with GAD2 and Epilepsy
 Inflammation Antibodies  >6 publications with GAD2 and Inflammation
 Seizures Antibodies  >6 publications with GAD2 and Seizures
 Depressive Disorder Antibodies  >5 publications with GAD2 and Depressive Disorder
 Depressive Disorder, Major Antibodies  >3 publications with GAD2 and Depressive Disorder, Major

Organs/Tissues associated with anti-GAD2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >54 publications with GAD2 and Brain
 Pancreas Antibodies  >4 publications with GAD2 and Pancreas
 Uncharacterized Tissue Antibodies  >1 publications with GAD2 and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000