• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NAA15 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178695

Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection.Background: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NARG1 (NAA15), Polyclonal Antibody
Full Product Name
Anti-NARG1 Antibody
Product Gene Name
anti-NAA15 antibody
Product Synonym Names
ASTBDN; GA19; mNAT1; Naa15; NATH; Tbdn 1; Tbdn100; tubedown-1; Q9BXJ9; N-alpha-acetyltransferase 15, NatA auxiliary subunit
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
61,602 Da
OMIM
AY039242 mRNA
3D Structure
ModBase 3D Structure for Q9BXJ9
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-NAA15 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-NAA15 antibody
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml

Western Blot (WB) of anti-NAA15 antibody

Western blot analysis of NARG1 expression in 293T whole cell lysates (lane 1). NARG1 at 101KD was detected using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-NAA15 Polyclonal Antibody – Cat# MBS178695

Immunohistochemistry (IHC) of anti-NAA15 antibody

NARG1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- NARG1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-NAA15 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178695

Product References and Citations for anti-NAA15 antibody

1. Arnesen, T., Anderson, D., Baldersheim, C., Lanotte, M., Varhaug, J. E., Lillehaug, J. R. Identification and characterization of the human ARD1-NATH protein acetyltransferase complex. Biochem. J. 386: 433-443, 2005.
2. Fluge, O., Bruland, O., Akslen, L. A., Varhaug, J. E., Lillehaug, J. R. NATH, a novel gene overexpressed in papillary thyroid carcinomas. Oncogene 21: 5056-5068, 2002.
3. Sugiura, N., Patel, R. G., Corriveau, R. A. N-methyl-D-aspartate receptors regulate a group of transiently expressed genes in the developing brain. J. Biol. Chem. 276: 14257-14263, 2001.

Other Notes

Small volumes of anti-NAA15 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NAA15 purchase

MBS178695 is an antibody targeting NAA15. Also known as Anti-NARG1 Antibody. Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for NAA15. It may not necessarily be applicable to this product.

NCBI GI #
17149828
NCBI GeneID
80155
NCBI Accession #
NP_476516.1
UniProt Primary Accession #
Q9BXJ9
UniProt Secondary Accession #
Q52LG9; Q8IWH4; Q8NEV2; Q9H8P6; D3DNY6
UniProt Related Accession #
Q9BXJ9
GenBank Nucleotide #
NM_057175.4
NCBI Official Full Name
N-alpha-acetyltransferase 15, NatA auxiliary subunit
NCBI Official Synonym Full Names
N(alpha)-acetyltransferase 15, NatA auxiliary subunit
NCBI Official Symbol
NAA15
NCBI Official Synonym Symbols
Ga19; NATH; TBDN; NARG1; NAT1P; TBDN100
UniProt Protein Name
N-alpha-acetyltransferase 15, NatA auxiliary subunit
UniProt Synonym Protein Names
Gastric cancer antigen Ga19; N-terminal acetyltransferase; NMDA receptor-regulated protein 1; Protein tubedown-1; Tbdn100
Protein Family
N-alpha-acetyltransferase
UniProt Gene Name
NAA15
UniProt Synonym Gene Names
GA19; NARG1; NATH; TBDN100
NCBI Protein Information
N-alpha-acetyltransferase 15, NatA auxiliary subunit

NCBI Summary for NAA15

N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes the auxillary subunit of the N-terminal acetyltransferase A (NatA) complex. [provided by RefSeq, Jan 2017]
Show more

UniProt Comments for NAA15

NAA15: The NAA10-NAA15 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Acetyltransferase

Chromosomal Location of Human Ortholog: 4q31.1

Cellular Component: cytoplasm; membrane; nucleus; transcription factor complex

Molecular Function: acetyltransferase activity; peptide alpha-N-acetyltransferase activity; protein binding; ribosome binding

Biological Process: N-terminal peptidyl-methionine acetylation; N-terminal protein amino acid acetylation; negative regulation of apoptosis; positive regulation of transcription, DNA-dependent; protein stabilization
Show more

Research Articles on NAA15

1. Human Naa15 (NATH) and Naa10 (ARD1) form a stable NatA complex which associates with ribosomes and performs co-translational N-terminal acetylation; Naa15 (NATH) and Naa10 (ARD1) are cleaved during apoptosis resulting in decreased acetyltransferase activity

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NAA15 antibody

 Reference Product  PubMed Publications
 NAA10 antibody  >10 publications with NAA15 and NAA10
 NAA50 antibody  >3 publications with NAA15 and NAA50
 NARG2 antibody  >1 publications with NAA15 and NARG2
 NAA11 antibody  >1 publications with NAA15 and NAA11

Pathways associated with anti-NAA15 antibody

 Products by Pathway  Pathway Diagram
 Endoderm Differentiation Pathway antibodies  Endoderm Differentiation Pathway Diagram

Diseases associated with anti-NAA15 antibody

 Disease Name  Pubmed Publications
 Cognition Disorders Antibodies  >1 publications with NAA15 and Cognition Disorders
 Nerve Degeneration Antibodies  >1 publications with NAA15 and Nerve Degeneration

Organs/Tissues associated with anti-NAA15 antibody

 Organ/Tissue Name  Pubmed Publications
 Vascular Antibodies  >4 publications with NAA15 and Vascular
 Eye Antibodies  >3 publications with NAA15 and Eye
 Brain Antibodies  >3 publications with NAA15 and Brain
 Thyroid Antibodies  >2 publications with NAA15 and Thyroid
 Blood Antibodies  >2 publications with NAA15 and Blood
 Spleen Antibodies  >1 publications with NAA15 and Spleen
 Heart Antibodies  >1 publications with NAA15 and Heart
 Uterus Antibodies  >1 publications with NAA15 and Uterus
 Testis Antibodies  >1 publications with NAA15 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000