Rabbit Anti-LMO1 Polyclonal Antibody – Cat# MBS178699

Western blot analysis of LMO1 expression in rat brain extract (lane 1), NIH3T3 whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). LMO1 at 18KD was detected using rabbit anti- LMO1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

LMO1 Antibody – Rabbit Polyclonal

Name: LMO1 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178699
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178699

Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection.Background: Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LMO1, Polyclonal Antibody

Full Product Name

Anti-LMO1 Antibody

Product Gene Name

anti-LMO1 antibody

Product Synonym Names

LMO1; LMO-1; LMO 1; RBTN 1; RBTN1; RHOM 1; RHOM1; Rhombotin1; Rhombotin-1; Rhombotin 1; TTG 1; TTG1; P25800; LIM domain only 1

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen affinity purified.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

17,697 Da

OMIM

M26682 mRNA

3D Structure

ModBase 3D Structure for P25800

Notes

Tested Species: In-house tested species with positive results.
Other applications have not been tested.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-LMO1 antibody

Western Blot (WB)

Application Notes for anti-LMO1 antibody

Western Blot: 0.1-0.5ug/ml

Product References and Citations for anti-LMO1 antibody

1. "Entrez Gene: LMO1 LIM domain only 1 (rhombotin 1)".
2. Boehm T, Foroni L, Kaneko Y, Perutz MF, Rabbitts TH (June 1991). "The rhombotin family of cysteine-rich LIM-domain oncogenes: distinct members are involved in T-cell translocations to human chromosomes 11p15 and 11p13". Proc Natl Acad Sci U S A. 88 (10): 4367-71.
3. McGuire EA, Davis AR, Korsmeyer SJ (March 1991). "T-cell translocation gene 1 (Ttg-1) encodes a nuclear protein normally expressed in neural lineage cells". Blood. 77 (3): 599-606.

Other Notes

Small volumes of anti-LMO1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LMO1 purchase

MBS178699 is an antibody targeting LMO1. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for LMO1. It may not necessarily be applicable to this product.

NCBI GI #

394025675

NCBI GeneID

4004

NCBI Accession #

NP_001257357.1

UniProt Primary Accession #

P25800

UniProt Secondary Accession #

Q4VBC5; Q8IXR0; E9PSF5

UniProt Related Accession #

P25800

GenBank Nucleotide #

NM_001270428.1

NCBI Official Full Name

rhombotin-1 isoform b

NCBI Official Synonym Full Names

LIM domain only 1

NCBI Official Symbol

LMO1

NCBI Official Synonym Symbols

TTG1; RBTN1; RHOM1

UniProt Protein Name

Rhombotin-1

UniProt Synonym Protein Names

Cysteine-rich protein TTG-1; LIM domain only protein 1; LMO-1; T-cell translocation protein 1

Protein Family

Rhombotin

UniProt Gene Name

LMO1

UniProt Synonym Gene Names

RBTN1; RHOM1; TTG1; LMO-1

NCBI Protein Information

rhombotin-1

NCBI Summary for LMO1

This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2012]

UniProt Comments for LMO1

LMO1: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.

Protein type: DNA-binding; Oncoprotein

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: positive regulation of transcription from RNA polymerase II promoter

Research Articles on LMO1

1. LMO1 appears to be a coactivator of AR involved in the progression of prostate cancer

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-LMO1 antibody

Reference Product	PubMed Publications
TAL1 antibody	>30 publications with LMO1 and TAL1
LYL1 antibody	>9 publications with LMO1 and LYL1
LDB1 antibody	>9 publications with LMO1 and LDB1
GATA3 antibody	>8 publications with LMO1 and GATA3
GATA2 antibody	>3 publications with LMO1 and GATA2
TAL2 antibody	>2 publications with LMO1 and TAL2
LDB2 antibody	>2 publications with LMO1 and LDB2

Diseases associated with anti-LMO1 antibody

Disease Name	Pubmed Publications
Leukemia, T-Cell Antibodies	>46 publications with LMO1 and Leukemia, T-Cell
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Antibodies	>15 publications with LMO1 and Precursor T-Cell Lymphoblastic Leukemia-Lymphoma
Breast Neoplasms Antibodies	>5 publications with LMO1 and Breast Neoplasms
Disease Models, Animal Antibodies	>4 publications with LMO1 and Disease Models, Animal
Lung Neoplasms Antibodies	>2 publications with LMO1 and Lung Neoplasms
Neoplasms, Experimental Antibodies	>2 publications with LMO1 and Neoplasms, Experimental
Seizures Antibodies	>2 publications with LMO1 and Seizures
Neural Tube Defects Antibodies	>1 publications with LMO1 and Neural Tube Defects
Abnormalities, Multiple Antibodies	>1 publications with LMO1 and Abnormalities, Multiple
Hyperplasia Antibodies	>1 publications with LMO1 and Hyperplasia

Organs/Tissues associated with anti-LMO1 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>17 publications with LMO1 and Brain
Lung Antibodies	>4 publications with LMO1 and Lung
Muscle Antibodies	>4 publications with LMO1 and Muscle
Prostate Antibodies	>3 publications with LMO1 and Prostate
Testis Antibodies	>2 publications with LMO1 and Testis
Pancreas Antibodies	>1 publications with LMO1 and Pancreas