• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DHODH Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178812

Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection.Background: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DHODH, Polyclonal Antibody
Full Product Name
Anti-DHODH Antibody
Product Gene Name
anti-DHODH antibody
Product Synonym Names
DHOdehase; Dhodh; POADS; URA1; Q02127; Dihydroorotate dehydrogenase (quinone), mitochondrial
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
42,867 Da
OMIM
M94065 mRNA
3D Structure
ModBase 3D Structure for Q02127
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-DHODH antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-DHODH antibody
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml

Western Blot (WB) of anti-DHODH antibody

Western blot analysis of DHODH expression in rat liver extract (lane 1), mouse spleen extract (lane 2) and HEPG2 whole cell lysates (lane 3). DHODH at 43KD was detected using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-DHODH Polyclonal Antibody – Cat# MBS178812

Immunohistochemistry (IHC) of anti-DHODH antibody

DHODH was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-DHODH Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178812

Immunohistochemistry (IHC) of anti-DHODH antibody

DHODH was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-DHODH Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178812

Immunohistochemistry (IHC) of anti-DHODH antibody

DHODH was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DHODH Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-DHODH Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178812

Product References and Citations for anti-DHODH antibody

1. Ng, S. B., Buckingham, K. J., Lee, C., Bigham, A. W., Tabor, H. K., Dent, K. M., Huff, C. D., Shannon, P. T., Jabs, E. W., Nickerson, D. A., Shendure, J., Bamshad, M. J. Exome sequencing identifies the cause of a mendelian disorder. Nature Genet. 42: 30-35, 2010.
2. White, R. M., Cech, J., Ratanasirintrawoot, S., Lin, C. Y., Rahl, P. B., Burke, C. J., Langdon, E., Tomlinson, M. L., Mosher, J., Kaufman, C., Chen, F., Long, H. K., Kramer, M., Datta, S., Neuberg, D., Granter, S., Young, R. A., Morrison, S., Wheeler, G. N., Zon, L. I. DHODHmodulates transcriptional elongation in the neural crest and melanoma. Nature 471: 518-522, 2011.

Other Notes

Small volumes of anti-DHODH antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DHODH purchase

MBS178812 is an antibody targeting DHODH. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for DHODH. It may not necessarily be applicable to this product.

NCBI GI #
45006951
NCBI GeneID
1723
NCBI Accession #
NP_001352.2
UniProt Primary Accession #
Q02127
UniProt Secondary Accession #
Q6P176; A8K8C8
UniProt Related Accession #
Q02127
GenBank Nucleotide #
NM_001361.4
NCBI Official Full Name
dihydroorotate dehydrogenase (quinone), mitochondrial
NCBI Official Synonym Full Names
dihydroorotate dehydrogenase (quinone)
NCBI Official Symbol
DHODH
NCBI Official Synonym Symbols
URA1; POADS; DHOdehase
UniProt Protein Name
Dihydroorotate dehydrogenase (quinone), mitochondrial
UniProt Synonym Protein Names
Dihydroorotate oxidase
UniProt Gene Name
DHODH
UniProt Synonym Gene Names
DHOdehase
NCBI Protein Information
dihydroorotate dehydrogenase (quinone), mitochondrial

NCBI Summary for DHODH

The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for DHODH

DHODH: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. Defects in DHODH are the cause of postaxial acrofacial dysostosis (POADS); also known as Miller syndrome. POADS is characterized by severe micrognathia, cleft lip and/or palate, hypoplasia or aplasia of the posterior elements of the limbs, coloboma of the eyelids and supernumerary nipples. POADS is a very rare disorder: only 2 multiplex families, each consisting of 2 affected siblings born to unaffected, nonconsanguineous parents, have been described among a total of around 30 reported cases. Belongs to the dihydroorotate dehydrogenase family. Type 2 subfamily.

Protein type: EC 1.3.5.2; Membrane protein, integral; Mitochondrial; Nucleotide Metabolism - pyrimidine; Oxidoreductase

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: cytoplasm; mitochondrial inner membrane; mitochondrion; nucleoplasm

Molecular Function: dihydroorotate dehydrogenase activity

Biological Process: 'de novo' pyrimidine base biosynthetic process; pyrimidine nucleoside biosynthetic process

Disease: Postaxial Acrofacial Dysostosis
Show more

Research Articles on DHODH

1. This is the first study to report on conformational changes of the HsDHODH N-terminal microdomain through a combination of CD and DEER spectroscopic techniques

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DHODH antibody

 Reference Product  PubMed Publications
 CAD antibody  >3 publications with DHODH and CAD
 UMPS antibody  >2 publications with DHODH and UMPS

Pathways associated with anti-DHODH antibody

 Products by Pathway  Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Nucleotides Pathway antibodies  Metabolism Of Nucleotides Pathway Diagram
 Pyrimidine Biosynthesis Pathway antibodies  Pyrimidine Biosynthesis Pathway Diagram
 Pyrimidine Metabolism Pathway antibodies  Pyrimidine Metabolism Pathway Diagram
 Pyrimidine Metabolism Pathway antibodies  Pyrimidine Metabolism Pathway Diagram
 Pyrimidine Metabolism Pathway antibodies  Pyrimidine Metabolism Pathway Diagram
 Uridine Monophosphate Biosynthesis, Glutamine (+ PRPP) => UMP Pathway antibodies  Uridine Monophosphate Biosynthesis, Glutamine (+ PRPP) => UMP Pathway Diagram
 Uridine Monophosphate Biosynthesis, Glutamine (+ PRPP) => UMP Pathway antibodies  Uridine Monophosphate Biosynthesis, Glutamine (+ PRPP) => UMP Pathway Diagram

Diseases associated with anti-DHODH antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >8 publications with DHODH and Inflammation
 Congenital Abnormalities Antibodies  >8 publications with DHODH and Congenital Abnormalities
 Death Antibodies  >5 publications with DHODH and Death
 Cardiovascular Diseases Antibodies  >4 publications with DHODH and Cardiovascular Diseases
 Edema Antibodies  >2 publications with DHODH and Edema
 Liver Diseases Antibodies  >2 publications with DHODH and Liver Diseases
 Fatty Liver Antibodies  >2 publications with DHODH and Fatty Liver
 Hyperplasia Antibodies  >2 publications with DHODH and Hyperplasia
 Necrosis Antibodies  >2 publications with DHODH and Necrosis
 Abnormalities, Drug-Induced Antibodies  >1 publications with DHODH and Abnormalities, Drug-Induced

Organs/Tissues associated with anti-DHODH antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >27 publications with DHODH and Blood
 Liver Antibodies  >15 publications with DHODH and Liver
 Kidney Antibodies  >4 publications with DHODH and Kidney
 Vascular Antibodies  >4 publications with DHODH and Vascular
 Bone Marrow Antibodies  >4 publications with DHODH and Bone Marrow
 Spleen Antibodies  >3 publications with DHODH and Spleen
 Muscle Antibodies  >3 publications with DHODH and Muscle
 Skin Antibodies  >3 publications with DHODH and Skin
 Lymph Antibodies  >3 publications with DHODH and Lymph
 Prostate Antibodies  >2 publications with DHODH and Prostate
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000