Rabbit Anti-PSMA4 Polyclonal Antibody – Cat# MBS178846

Western blot analysis of PSMA4 expression in rat liver extract (lane 1), mouse spleen extract (lane 2) and HELA whole cell lysates (lane 3). PSMA4 at 29KD was detected using rabbit anti- PSMA4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

PSMA4 Antibody – Rabbit Polyclonal

Name: PSMA4 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178846
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178846

Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection.Background: Proteasome subunit alpha type-4, also known as macropain subunit C9, proteasome component C9, and 20S proteasome subunit alpha-3, is a protein that in humans is… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PSMA4, Polyclonal Antibody

Full Product Name

Anti-PSMA4 Antibody

Product Gene Name

anti-PSMA4 antibody

Product Synonym Names

HC9; Macropain subunit C9; PSC9; PSMA 4; psmA4; P25789; Proteasome subunit alpha type-4; proteasome subunit alpha 4

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen affinity purified.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

21,365 Da

OMIM

D00763 mRNA

3D Structure

ModBase 3D Structure for P25789

Notes

Tested Species: In-house tested species with positive results.
Other applications have not been tested.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-PSMA4 antibody

Western Blot (WB)

Application Notes for anti-PSMA4 antibody

Western Blot: 0.1-0.5ug/ml

Product References and Citations for anti-PSMA4 antibody

1. Groll M, Ditzel L, Löwe J, Stock D, Bochtler M, Bartunik HD, Huber R (Apr 1997). "Structure of 20S proteasome from yeast at 2.4 A resolution". Nature 386 (6624): 463-71.
2. Tomko RJ, Hochstrasser M (2013). "Molecular architecture and assembly of the eukaryotic proteasome". Annual Review of Biochemistry 82: 415-45.

Other Notes

Small volumes of anti-PSMA4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PSMA4 purchase

MBS178846 is an antibody targeting PSMA4. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PSMA4. It may not necessarily be applicable to this product.

NCBI GI #

156713442

NCBI GeneID

5685

NCBI Accession #

NP_001096137.1

UniProt Primary Accession #

P25789

UniProt Secondary Accession #

Q53XP2; Q567Q5; Q8TBD1; D3DW86

UniProt Related Accession #

P25789

GenBank Nucleotide #

NM_001102667.2

NCBI Official Full Name

proteasome subunit alpha type-4 isoform 1

NCBI Official Synonym Full Names

proteasome subunit alpha 4

NCBI Official Symbol

PSMA4

NCBI Official Synonym Symbols

HC9; PSC9; HsT17706

UniProt Protein Name

Proteasome subunit alpha type-4

UniProt Synonym Protein Names

Macropain subunit C9; Multicatalytic endopeptidase complex subunit C9; Proteasome component C9; Proteasome subunit L

Protein Family

Phenol-soluble modulin alpha 4 peptide

UniProt Gene Name

PSMA4

UniProt Synonym Gene Names

HC9; PSC9

NCBI Protein Information

proteasome subunit alpha type-4

NCBI Summary for PSMA4

This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016]

UniProt Comments for PSMA4

PSMA4: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Belongs to the peptidase T1A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.25.1; Protease; Proteasome complex

Chromosomal Location of Human Ortholog: 15q25.1

Cellular Component: cytoplasm; cytosol; intracellular membrane-bound organelle; nucleoplasm; nucleus; proteasome complex; proteasome core complex

Molecular Function: protein binding

Biological Process: anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; MAPKKK cascade; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; regulation of amino acid metabolic process; regulation of mRNA stability; stimulatory C-type lectin receptor signaling pathway; T cell receptor signaling pathway; tumor necrosis factor-mediated signaling pathway; Wnt receptor signaling pathway, planar cell polarity pathway

Research Articles on PSMA4

1. rs12901682 is associated with lung cancer risk in a Chinese Han population.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PSMA4 antibody

Reference Product	PubMed Publications
PSMA3 antibody	>4 publications with PSMA4 and PSMA3
PSMB2 antibody	>3 publications with PSMA4 and PSMB2
PSMA6 antibody	>2 publications with PSMA4 and PSMA6
PSMA7 antibody	>2 publications with PSMA4 and PSMA7
PSMA2 antibody	>2 publications with PSMA4 and PSMA2
PSMA1 antibody	>2 publications with PSMA4 and PSMA1
PSMB1 antibody	>2 publications with PSMA4 and PSMB1
PSMB6 antibody	>1 publications with PSMA4 and PSMB6
PSMA5 antibody	>1 publications with PSMA4 and PSMA5

Pathways associated with anti-PSMA4 antibody

Products by Pathway	Pathway Diagram
ABC Transporter Disorders Pathway antibodies	ABC Transporter Disorders Pathway Diagram
ABC-family Proteins Mediated Transport Pathway antibodies	ABC-family Proteins Mediated Transport Pathway Diagram
APC/C-mediated Degradation Of Cell Cycle Proteins Pathway antibodies	APC/C-mediated Degradation Of Cell Cycle Proteins Pathway Diagram
APC/C:Cdc20 Mediated Degradation Of Securin Pathway antibodies	APC/C:Cdc20 Mediated Degradation Of Securin Pathway Diagram
APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies	APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway antibodies	APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway Diagram
APC:Cdc20 Mediated Degradation Of Cell Cycle Proteins Prior To Satisfation Of The Cell Cycle Checkpoint Pathway antibodies	APC:Cdc20 Mediated Degradation Of Cell Cycle Proteins Prior To Satisfation Of The Cell Cycle Checkpoint Pathway Diagram
ARMS-mediated Activation Pathway antibodies	ARMS-mediated Activation Pathway Diagram
AUF1 (hnRNP D0) Binds And Destabilizes MRNA Pathway antibodies	AUF1 (hnRNP D0) Binds And Destabilizes MRNA Pathway Diagram
Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies	Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram

Diseases associated with anti-PSMA4 antibody

Disease Name	Pubmed Publications
Lung Neoplasms Antibodies	>7 publications with PSMA4 and Lung Neoplasms
Carcinoma Antibodies	>4 publications with PSMA4 and Carcinoma
Nervous System Diseases Antibodies	>1 publications with PSMA4 and Nervous System Diseases
Cardiovascular Diseases Antibodies	>1 publications with PSMA4 and Cardiovascular Diseases
Hypertension Antibodies	>1 publications with PSMA4 and Hypertension
Inflammation Antibodies	>1 publications with PSMA4 and Inflammation

Organs/Tissues associated with anti-PSMA4 antibody

Organ/Tissue Name	Pubmed Publications
Lung Antibodies	>8 publications with PSMA4 and Lung
Nerve Antibodies	>6 publications with PSMA4 and Nerve
Blood Antibodies	>4 publications with PSMA4 and Blood
Brain Antibodies	>3 publications with PSMA4 and Brain
Mammary Gland Antibodies	>1 publications with PSMA4 and Mammary Gland
Vascular Antibodies	>1 publications with PSMA4 and Vascular
Uterus Antibodies	>1 publications with PSMA4 and Uterus
Muscle Antibodies	>1 publications with PSMA4 and Muscle
Skin Antibodies	>1 publications with PSMA4 and Skin
Liver Antibodies	>1 publications with PSMA4 and Liver