• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SUB1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178854

Rabbit IgG polyclonal antibody for Activated RNA polymerase II transcriptional coactivator p15(SUB1) detection.Background: Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PC4 (SUB1), Polyclonal Antibody
Full Product Name
Anti-PC4 Antibody
Product Gene Name
anti-SUB1 antibody
Product Synonym Names
p14; P15; PC4; PC4 LSB; Positive cofactor 4; RPO2TC1; Sub1; P53999; Activated RNA polymerase II transcriptional coactivator p15; SUB1 homolog, transcriptional regulator
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen affinity purified.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
14,395 Da
OMIM
X79805 mRNA
3D Structure
ModBase 3D Structure for P53999
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-SUB1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-SUB1 antibody
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml

Western Blot (WB) of anti-SUB1 antibody

Western blot analysis of PC4 expression in rat liver extract (lane 1), HELA whole cell lysates (lane 2) and U2OS whole cell lysates (lane 3). PC4 at 19KD was detected using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-SUB1 Polyclonal Antibody – Cat# MBS178854

Immunohistochemistry (IHC) of anti-SUB1 antibody

PC4 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-SUB1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178854

Immunohistochemistry (IHC) of anti-SUB1 antibody

PC4 was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-SUB1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178854

Immunohistochemistry (IHC) of anti-SUB1 antibody

PC4 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Rabbit Anti-SUB1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178854

Product References and Citations for anti-SUB1 antibody

1. "Entrez Gene SUB1: SUB1 homolog (S. cerevisiae)".
2. Kretzschmar M, Kaiser K, Lottspeich F, Meisterernst M (August 1994). "A novel mediator of class II gene transcription with homology to viral immediate-early transcriptional regulators". Cell 78 (3): 525-34.
3. Ge H, Roeder RG (August 1994). "Purification, cloning, and characterization of a human coactivator, PC4, that mediates transcriptional activation of class II genes". Cell 78 (3): 513-23.

Other Notes

Small volumes of anti-SUB1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SUB1 purchase

MBS178854 is an antibody targeting SUB1. Also known as Anti-PC4 Antibody. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for SUB1. It may not necessarily be applicable to this product.

NCBI GI #
217330646
NCBI GeneID
10923
NCBI Accession #
NP_006704.3
UniProt Primary Accession #
P53999
UniProt Secondary Accession #
Q96L29
UniProt Related Accession #
P53999
GenBank Nucleotide #
NM_006713.3
NCBI Official Full Name
activated RNA polymerase II transcriptional coactivator p15
NCBI Official Synonym Full Names
SUB1 homolog, transcriptional regulator
NCBI Official Symbol
SUB1
NCBI Official Synonym Symbols
P15; PC4; p14
UniProt Protein Name
Activated RNA polymerase II transcriptional coactivator p15
UniProt Synonym Protein Names
Positive cofactor 4; PC4; SUB1 homolog; p14
Protein Family
Activated RNA polymerase II transcriptional coactivator
UniProt Gene Name
SUB1
UniProt Synonym Gene Names
PC4; RPO2TC1; PC4
NCBI Protein Information
activated RNA polymerase II transcriptional coactivator p15

UniProt Comments for SUB1

PC4: a transcriptional coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, nonspecifically to double-stranded DNA (ds DNA). Interacts with CSTF2. Its activity is controlled by phosphorylation of the regulatory domain. Phosphorylation inactivates both dsDNA-binding and cofactor function. Seems to be phosphorylated in vivo by CK2 in at least 7 sites in the N-terminal Ser-rich region.

Protein type: DNA-binding; Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5p13.3

Cellular Component: nucleolus; nucleus; transcription factor complex

Molecular Function: protein binding; single-stranded DNA binding; transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter
Show more

Research Articles on SUB1

1. PC4 associates with Aurora A and Aurora B and undergoes phosphorylation, following which PC4 activates both Aurora A and B to sustain optimal kinase activity to maintain the phosphorylation gradient for the proper functioning of the mitotic machinery.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SUB1 antibody

 Reference Product  PubMed Publications
 TBP antibody  >5 publications with SUB1 and TBP
 SSU72 antibody  >2 publications with SUB1 and SSU72
 HNF4A antibody  >1 publications with SUB1 and HNF4A

Diseases associated with anti-SUB1 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >6 publications with SUB1 and Carcinoma
 Lung Neoplasms Antibodies  >4 publications with SUB1 and Lung Neoplasms
 Breast Neoplasms Antibodies  >4 publications with SUB1 and Breast Neoplasms
 Nervous System Diseases Antibodies  >3 publications with SUB1 and Nervous System Diseases
 Neoplasm Invasiveness Antibodies  >2 publications with SUB1 and Neoplasm Invasiveness
 Ovarian Neoplasms Antibodies  >1 publications with SUB1 and Ovarian Neoplasms
 Adenocarcinoma Antibodies  >1 publications with SUB1 and Adenocarcinoma
 Learning Disorders Antibodies  >1 publications with SUB1 and Learning Disorders
 Neoplasm Metastasis Antibodies  >1 publications with SUB1 and Neoplasm Metastasis
 Hypertension Antibodies  >1 publications with SUB1 and Hypertension

Organs/Tissues associated with anti-SUB1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >15 publications with SUB1 and Blood
 Brain Antibodies  >6 publications with SUB1 and Brain
 Lung Antibodies  >4 publications with SUB1 and Lung
 Muscle Antibodies  >3 publications with SUB1 and Muscle
 Skin Antibodies  >3 publications with SUB1 and Skin
 Thyroid Antibodies  >3 publications with SUB1 and Thyroid
 Prostate Antibodies  >2 publications with SUB1 and Prostate
 Liver Antibodies  >2 publications with SUB1 and Liver
 Vascular Antibodies  >2 publications with SUB1 and Vascular
 Heart Antibodies  >2 publications with SUB1 and Heart
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000