• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CHI3L1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS249889

CHI3L1 Antibody, 39 kDa synovial protein Antibody, ASRT7 Antibody, Cartilage glycoprotein 39 Antibody, CGP-39 Antibody, Chitinase-3-like protein 1 Antibody, gp39 Antibody, HCGP-39 Antibody, HCGP-3P Antibody, GP-39 Antibody, HC-gp39 Antibody, YKL40 Antibody,… More details

$650 / 0.05 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CHI3L1 / YKL-40, Polyclonal Antibody
Full Product Name
Anti-CHI3L1 / YKL-40 Antibody IHC-plus
Product Gene Name
anti-CHI3L1 antibody
Product Synonym Gene Name
YKL-40
Product Synonym Names
CHI3L1 | 39 kDa synovial protein | ASRT7 | Cartilage glycoprotein 39 | CGP-39 | Chitinase-3-like protein 1 | gp39 | HCGP-39 | HCGP-3P | GP-39 | HC-gp39 | YKL40 | YYL-40 | YKL-40
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse
Form/Format
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity/Purification
Affinity purified
Concentration
3.07 mg/ml (lot specific)
Specificity
Human CHI3L1 / YKL-40
Preparation and Storage
Store at -20°C. Avoid freeze-thaw cycles.
Molecular Weight
Predicted MW: 42kDa
Observed MW by Western blot was 43kDa.
OMIM
601525
3D Structure
ModBase 3D Structure for P36222
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human CHI3L1 (NP_001267.2). YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTF
IKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHH
SPLFRGQEDASPDRFSNTDYA
Disclaimer
Due to the highly specific nature of antibodies and antigens, we cannot predict or be held responsible with respect to how this antibody will behave in your systems. Researchers using this antibody should conduct optimization studies to achieve the most optimal result possible for their intended application.
Recommended Immunohistochemistry Protocol
The following protocol is a recommendation only, and MyBioSource, Inc. makes no guarantee of the results:

Tissue Preparation:
Formalin fixation and embedding in paraffin wax.

Tissue Sectioning:
Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C.

Deparaffinization:
Wash dry slides in 3 changes of xylene - 5 minutes each @ RT

Rehydration:
Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT
Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT
Wash slides in 1 change of 80% alcohol - 3 minutes @ RT
Rinse slides in gentle running distilled water - 5 minutes @ RT

Antigen retrieval:
Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes
Remove from heat and let stand at room temperature in buffer - 20 minutes
Rinse in 1X TBS with Tween (TBST) -1 minute @ RT

Immunostaining:
(Do not allow tissues to dry at any time during the staining procedure)
Apply a universal protein block - 20 minutes @ RT
Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT
Rinse slides in 1 X TBST - 1 minute @ RT
Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT
Rinse slides in 1X TBST -1 minute @ RT
Apply alkaline phosphatase streptavidin - 30 minutes @ RT
Rinse slides in 1X TBST -1 minute @ RT
Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT
Wash slides in distilled water - 1 minute @ RT

Dehydrate:
(This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB)
Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT
Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT
Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT
Wash slides in 3 changes of xylene - 1 minute each @ RT
Apply coverslip
Applications Tested/Suitable for anti-CHI3L1 antibody
Immunohistochemistry (IHC), Immunohistochemistry (IHC-P) Paraffin, Western Blot (WB)
Application Notes for anti-CHI3L1 antibody
IHC - Paraffin (1:200)
Western blot (1:500 - 1:2000)

Immunohistochemistry - Paraffin (IHC) of anti-CHI3L1 antibody

Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Rabbit Anti-CHI3L1 Polyclonal Antibody – Cat# MBS249889

Western Blot (WB) of anti-CHI3L1 antibody

Western blot analysis of extracts of THP1 cells, using CHI3L1 antibody.
Rabbit Anti-CHI3L1 Polyclonal Antibody, Western Blot (WB) – Cat# MBS249889

Other Notes

Small volumes of anti-CHI3L1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CHI3L1 purchase

MBS249889 is an antibody targeting CHI3L1. Also known as Anti-CHI3L1 / YKL-40 Antibody IHC-plus. Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for CHI3L1. It may not necessarily be applicable to this product.

NCBI GI #
144226251
NCBI GeneID
1116
NCBI Accession #
NP_001267.2
UniProt Primary Accession #
P36222
UniProt Secondary Accession #
P30923; Q8IVA4; Q96HI7; B2R7B0
UniProt Related Accession #
P36222
GenBank Nucleotide #
NM_001276.2
NCBI Official Full Name
chitinase-3-like protein 1
NCBI Official Synonym Full Names
chitinase 3 like 1
NCBI Official Symbol
CHI3L1
NCBI Official Synonym Symbols
GP39; ASRT7; GP-39; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39
UniProt Protein Name
Chitinase-3-like protein 1
UniProt Synonym Protein Names
39 kDa synovial protein; Cartilage glycoprotein 39; CGP-39; GP-39; hCGP-39; YKL-40
Protein Family
Chitinase-3-like protein
UniProt Gene Name
CHI3L1
UniProt Synonym Gene Names
CGP-39; GP-39; hCGP-39
UniProt Entry Name
CH3L1_HUMAN
NCBI Protein Information
chitinase-3-like protein 1

NCBI Summary for CHI3L1

Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling. [provided by RefSeq, Sep 2009]
Show more

UniProt Comments for CHI3L1

CHI3L1: Carbohydrate-binding lectin with a preference for chitin. May play a role in defense against pathogens, or in tissue remodeling. May play an important role in the capacity of cells to respond to and cope with changes in their environment. A genetic variation in CHI3L1 is associated with susceptibility to asthma-related traits type 7 (ASRT7). Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing and dyspnea, bronchial hyperresponsiveness (BHR) as assessed by methacholine challenge test, serum IgE levels, atopy, and atopic dermatitis. Belongs to the glycosyl hydrolase 18 family.

Protein type: Secreted, signal peptide; Cell adhesion; Secreted

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: cytoplasm; endoplasmic reticulum; extracellular space; perinuclear region of cytoplasm; proteinaceous extracellular matrix

Molecular Function: carbohydrate binding; chitin binding; chitinase activity; extracellular matrix structural constituent

Biological Process: activation of NF-kappaB-inducing kinase; apoptosis; carbohydrate metabolic process; cartilage development; chitin catabolic process; inflammatory response; lung development; positive regulation of angiogenesis; positive regulation of protein kinase B signaling cascade; response to mechanical stimulus

Disease: Asthma-related Traits, Susceptibility To, 7; Schizophrenia
Show more

Research Articles on CHI3L1

1. YKL40-positive glioblastoma multiforme is significantly linked to subventricular zone types of brain neoplasms.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CHI3L1 antibody

 Reference Product  PubMed Publications
 TNF antibody  >36 publications with CHI3L1 and TNF
 EGFR antibody  >11 publications with CHI3L1 and EGFR
 STAT3 antibody  >8 publications with CHI3L1 and STAT3
 MMP9 antibody  >7 publications with CHI3L1 and MMP9
 IL18 antibody  >5 publications with CHI3L1 and IL18
 IL8 antibody  >3 publications with CHI3L1 and IL8
 CEBPA antibody  >1 publications with CHI3L1 and CEBPA

Diseases associated with anti-CHI3L1 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >228 publications with CHI3L1 and Inflammation
 Lung Diseases Antibodies  >99 publications with CHI3L1 and Lung Diseases
 Nervous System Diseases Antibodies  >81 publications with CHI3L1 and Nervous System Diseases
 Brain Diseases Antibodies  >70 publications with CHI3L1 and Brain Diseases
 Fibrosis Antibodies  >66 publications with CHI3L1 and Fibrosis
 Glioma Antibodies  >52 publications with CHI3L1 and Glioma
 Glioblastoma Antibodies  >51 publications with CHI3L1 and Glioblastoma
 Osteoarthritis Antibodies  >49 publications with CHI3L1 and Osteoarthritis
 Liver Diseases Antibodies  >45 publications with CHI3L1 and Liver Diseases
 Heart Diseases Antibodies  >45 publications with CHI3L1 and Heart Diseases

Organs/Tissues associated with anti-CHI3L1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >400 publications with CHI3L1 and Blood
 Lung Antibodies  >87 publications with CHI3L1 and Lung
 Brain Antibodies  >82 publications with CHI3L1 and Brain
 Liver Antibodies  >54 publications with CHI3L1 and Liver
 Connective Tissue Antibodies  >52 publications with CHI3L1 and Connective Tissue
 Bone Antibodies  >48 publications with CHI3L1 and Bone
 Kidney Antibodies  >17 publications with CHI3L1 and Kidney
 Intestine Antibodies  >16 publications with CHI3L1 and Intestine
 Skin Antibodies  >15 publications with CHI3L1 and Skin
 Lymph Node Antibodies  >12 publications with CHI3L1 and Lymph Node
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000