• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Defensin, Beta-2 (A.a. 4-41) (DEFB2) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS311949

MAb to beta-Defensin-2 (a.a. 4-41)Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41) More details

$2195 / 1 mg +2 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Defensin, beta-2 (a.a. 4-41) (Defb2), Monoclonal Antibody
Full Product Name
MAb to beta-Defensin-2 (a.a. 4-41)
Product Gene Name
anti-Defb2 antibody
Product Synonym Names
MAb to beta-Defensin-2 (a.a. 4-41), Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41)
Clonality
Monoclonal
Isotype
IgG1
Host
Mouse
Form/Format
Lyophilized from Phopshate Buffered Saline, pH7.4
Purity/Purification
Purified, Lyophilized
Purification: Protein G Chromatography
Concentration
1 mg (Lyophilized) (lot specific)
Specificity
Synthetic human beta-Defensin 2 (a.a. 4-41)
Preparation and Storage
Store lyophilized product at 2-8°C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.
Chromosome Location
Chromosome: 8; NC_000074.5 (22950398..22953954). Location: 8 A4; 8 9.0 cM
3D Structure
ModBase 3D Structure for P82020
Source
Cell Culture Supernatant
Immunogen
Synthetic human beta-Defensin 2 (a.a. 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Reconstitution
In 1mL double distilled water for a 1mg vial
Important Note
Centrifuge before opening to ensure complete recovery of vial contents.

Product Categories/Family for anti-Defb2 antibody

Monoclonal Antibodies to Cytokines and Growth Factors
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-Defb2 antibody
ELISA (EIA)
Application Notes for anti-Defb2 antibody
Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Other Notes

Small volumes of anti-Defb2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Defb2 purchase

Native immune defenses include a shortlist of proteins like Defensin beta DefB. Beta Defensin binds to membrane of pathogens and aids in proteolysis. As a top candidate for drug development, a high quality, specific DefB2 antibody is critical to quantitate and evaluate localization and expression. Our anti DefB2 monoclonal antibody has been affinity purified and validated for ELISA. Immunohistochemistry applications - ICC / IHC - and other assay protocols will require antibody titre experiments. We recommend with sheep, rabbit or goat secondary antibodies anti mouse IgG, labeled with biotin for robust amplifications. Besides mouse anti Defb2, MyBiosource offers a DefB2 antibody polyclonal - ideal for ELISA kits pairs. Both are peptide derived to different human epitopes. Whether you chose a rabbit anti DefB2 or goat anti DefB2 antibodies, you are in good company. Join our family of satisfied customers and order anti defensin products with confidence. IHC WB datasheet included.

Additional Details

NCBI/Uniprot data below describe general gene information for Defb2. It may not necessarily be applicable to this product.

NCBI GI #
80478968
NCBI GeneID
13215
UniProt Primary Accession #
P82020
UniProt Related Accession #
P82020; Q32MH3
NCBI Official Full Name
Defensin beta 2
NCBI Official Synonym Full Names
defensin beta 2
NCBI Official Symbol
Defb2
NCBI Official Synonym Symbols
BD-2; MGC129140; MGC129141
UniProt Protein Name
Beta-defensin 2
UniProt Synonym Protein Names
Defensin, beta 2
UniProt Gene Name
Defb2
UniProt Entry Name
DEFB2_MOUSE
NCBI Protein Information
beta-defensin 2; OTTMUSP00000022725

UniProt Comments for Defb2

Function: Has bactericidal activity

Subcellular location: Secreted

Tissue specificity: Kidney, uterus and to a lesser extent in heart. Ref.1

Induction: In tracheal epithelium, by lipopolysaccharide or inflammation. Ref.1

Sequence similarities: Belongs to the beta-defensin family.

Research Articles on Defb2

1. Expression and inducibility of mouse beta-defensins-2 was tested in a mouse ocular surface scratch model with and without treatment of supernatants of a clinical Staphylococcus aureus isolate by means of immunohistochemistry.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-Defb2 antibody

 Disease Name  Pubmed Publications
 Disease Models, Animal Antibodies  >4 publications with Defb2 and Disease Models, Animal
 Lung Diseases Antibodies  >3 publications with Defb2 and Lung Diseases
 Intestinal Diseases Antibodies  >3 publications with Defb2 and Intestinal Diseases
 Inflammation Antibodies  >2 publications with Defb2 and Inflammation
 Lung Neoplasms Antibodies  >1 publications with Defb2 and Lung Neoplasms
 Metaplasia Antibodies  >1 publications with Defb2 and Metaplasia

Organs/Tissues associated with anti-Defb2 antibody

 Organ/Tissue Name  Pubmed Publications
 Epididymis Antibodies  >1 publications with Defb2 and Epididymis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000