• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Inhibin, Alpha Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS370081

Inhibins are peptide hormones produced by the granulosa cells in female follicles and by Sertoli cells in the male seminiferous tubules. They are selectively expressed by cells of sex-cord stromal derivation, and inhibit the secretion of follitropin by the… More details

$195 / 5 Slides +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Inhibin, alpha, Monoclonal Antibody
Full Product Name
Inhibin, alpha
Clonality
Monoclonal
Isotype
IgG2a
Clone Number
R1
Host
Mouse
Species Reactivity
Human, Dog, Cat
Form/Format
Inhibin alpha is a mouse monoclonal antibody derived from cell culture supernatant that is concentrated, dialyzed, filter sterilized and diluted in buffer pH 7.5, containing BSA and sodium azide as a preservative.
Preparation and Storage
Store at 2 to 8 degree C in the dark.
Immunogen
Synthetic peptide: MVLHLLFLLITPGGHSCQGLELARELVLAK, corresponding to amino acids 1-32 of human inhibin alpha.
Control
Adrenal Cortex, Placenta, Testis, Corpus Luteum
Localization
Cytoplasmic
Precautions
1. For professional users only. Results should be interpreted by a qualified medical professional.
2. This product contains <0.1% sodium azide (NaN?) as a preservative. Ensure proper handling procedures are used with this reagent.
3. Always wear personal protective equipment such as laboratory coat, goggles and gloves when handling reagents.
4. Dispose of unused solution with copious amount of water.
5. Do not ingest reagent. If reagent is ingested, seek medical advice immediately.
6. Avoid contact with eyes. If contact occurs, flush with large quantities of water.
7. Follow safety precautions of the heating device used for epitope retrieval.
Staining Procedure
1. Cut and mount 3-5 micron formalin-fixed paraffin-embedded tissues on positively charged slides.
2. Air dry for 2 hours at 58° C.
3. Deparaffinize, dehydrate and rehydrate tissues.
4. Subject tissues to heat induced epitope retrieval (HIER) using a suitable retrieval solution such as ImmunoDNA Retriever with Citrate.
5. Any of three heating methods may be used:

a. TintoRetriever Pressure Cooker or Equivalent
Place tissues/slides in a staining dish or coplin jar containing the ImmunoDNA Retriever with Citrate or EDTA, and place on trivet in the pressure cooker. Add 1-2 inches of distilled water to the pressure cooker and turn heat to high. Incubate for 15 minutes. Open and immediately transfer slides to room temperature.
b. TintoRetriever PT Module or Water Bath Method
Place tissues/slides in a pre-warmed staining dish or coplin jar containing the ImmunoDNA Retriever with Citrate or EDTA at 95°-99° C. Incubate for 30-60 minutes.
c. Conventional Steamer Method
Place tissues/slides in a pre-warmed staining dish or coplin jar containing the ImmunoDNA Retriever with Citrate or EDTA in a steamer, cover and steam for 30-60 minutes.

6. After heat treatment, transfer slides in ImmunoDNA Retriever with Citrate or EDTA to room temperature and let stand for 15-20 minutes.
7. For manual staining, perform antibody incubation at ambient temperature. For automated staining methods, perform antibody incubation according to instrument manufacturer’s instructions.
8. Wash slides with ImmunoDNA washer or DI water.
9. Continue IHC staining protocol. Wash slides between each step with ImmunoDNA washer solution.
Mounting Protocols
For detailed instructions using biodegradable permanent mounting media such as XyGreen PermaMounter or an organic solvent based resin.
Reactivity Note
Paraffin, Frozen
ISO Certification
Manufactured in an ISO 13485:2016 Certified Laboratory.

Dilution Information of anti-Inhibin, alpha antibody

Mouse Anti-Inhibin, Alpha Monoclonal Antibody – Cat# MBS370081

Abbreviated Immunohistochemical Protocol of anti-Inhibin, alpha antibody

Mouse Anti-Inhibin, Alpha Monoclonal Antibody, Abbreviated Immunohistochemical Protocol – Cat# MBS370081

Other Notes

Small volumes of anti-Inhibin, alpha antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Inhibin, alpha purchase

MBS370081 is an antibody targeting Inhibin, alpha. Reactive in Human, Dog, Cat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for Inhibin, alpha. It may not necessarily be applicable to this product.

NCBI GI #
208436014
NCBI Official Full Name
inhibin alpha
Protein Family
Inhibin

NCBI Summary for Inhibin, alpha

This gene encodes the alpha subunit of inhibins A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion.[provided by RefSeq, Dec 2010]
Show more

UniProt Comments for Inhibin, alpha

INHA: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: photoreceptor outer segment; photoreceptor inner segment; cell soma; extracellular region

Molecular Function: protein binding; growth factor activity; protein heterodimerization activity; hormone activity; cytokine activity; transforming growth factor beta receptor binding; receptor binding

Biological Process: hemoglobin biosynthetic process; negative regulation of B cell differentiation; nervous system development; regulation of cell cycle; male gonad development; signal transduction; negative regulation of interferon-gamma biosynthetic process; negative regulation of cell cycle; negative regulation of follicle-stimulating hormone secretion; regulation of cell proliferation; response to external stimulus; regulation of apoptosis; cell surface receptor linked signal transduction; cell-cell signaling; ovarian follicle development; negative regulation of macrophage differentiation; regulation of MAPKKK cascade; negative regulation of phosphorylation; erythrocyte differentiation; positive regulation of follicle-stimulating hormone secretion; cell differentiation; cell cycle arrest; cell development; skeletal development
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-Inhibin, alpha antibody

 Reference Product  PubMed Publications
 FLNA antibody  >12 publications with Inhibin, alpha and FLNA

Pathways associated with anti-Inhibin, alpha antibody

 Products by Pathway  Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 Salmonella Infection Pathway antibodies  Salmonella Infection Pathway Diagram
 Salmonella Infection Pathway antibodies  Salmonella Infection Pathway Diagram

Organs/Tissues associated with anti-Inhibin, alpha antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >13 publications with Inhibin, alpha and Bone
 Connective Tissue Antibodies  >4 publications with Inhibin, alpha and Connective Tissue
 Heart Antibodies  >3 publications with Inhibin, alpha and Heart
 Muscle Antibodies  >3 publications with Inhibin, alpha and Muscle
 Brain Antibodies  >3 publications with Inhibin, alpha and Brain
 Vascular Antibodies  >2 publications with Inhibin, alpha and Vascular
 Embryonic Tissue Antibodies  >2 publications with Inhibin, alpha and Embryonic Tissue
 Ear Antibodies  >1 publications with Inhibin, alpha and Ear
 Kidney Antibodies  >1 publications with Inhibin, alpha and Kidney
 Umbilical Cord Antibodies  >1 publications with Inhibin, alpha and Umbilical Cord
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000