• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Big Endothelin-3 Active Protein

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS407532

MBS407532 is an active protein targeting Big Endothelin-3. Also known as Big Endothelin-3 (Human, 1-41 Amide). More details

$615 / 0.1 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Big Endothelin-3, Active Protein
Full Product Name
Big Endothelin-3 (Human, 1-41 Amide)
Product Synonym Names
Big ET-3 (human); Big Endothelin-3 (1-41); amide human; Big ET-3 (1-41) amide (human); H-Cys-Thr-Cys-Phe-Thr-Tyr-Lys-Asp-Lys-Glu-Cys-Val-Tyr-Tyr-Cys-His-Leu-Asp-Ile-Ile-Trp-Ile-Asn-Thr-Pro-Glu-Gln-Thr-Val-Pro-Tyr-Gly-Leu-Ser-Asn-Tyr-Arg-Gly-Ser-Phe-Arg-NH2
Preparation and Storage
Store at -20 degree C
Molecular Weight
4923.65
Active Protein Note
Protein activity can be an ambiguous term. Please refer to the data sheet or inquire with Technical Support to determine the definition of activity for this product.
Molecular Formula
C223H322N56O63S4
Disulfide Bonds
Disulfide bonds between Cys1-Cys15 and Cys3-Cys11
One-Letter Code
H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
CAS Number
133551-97-0

Product Categories/Family for Big Endothelin-3 active protein

Biologically Active Peptides; Vasopressin, Vasotocin, & Related Peptides; Neurological

Product References and Citations for Big Endothelin-3 active protein

T. Kosaka, N. Suzuki, Y. Ishibashi, H. Matsumoto, Y. Itoh, S. Ohkubo, K. Ogi, C. Kitada, H. Onda, and M. Fujino, J. Biochem., 116, 443 (1994). (Original; Biosynthesis)
M. Yanagisawa and T. Masaki, Trends Pharmacol. Sci., 10, 374 (1989). (Review)
T. Sakurai, M. Yanagisawa, and T. Masaki, Trends Pharmacol. Sci., 13, 103 (1992). (Review)
K.D. Bloch, R.L. Eddy, T.B. Shows, and T. Quertermous, J. Biol. Chem., 264, 18156 (1989). (Original; cDNA)

Other Notes

Small volumes of Big Endothelin-3 active protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000