HBsAg Recombinant Protein – Cat# MBS434108

Hbsag Pres2 (HBsAg) Recombinant Protein

Name: HBsAg Recombinant Protein; Hbsag Pres2; Research Grade; MyBioSource
Brand: MyBioSource
SKU: MBS434108
Price: 350 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS434108

Description: The E Coli expressed recombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids and having a molecular weight of 5.7 kDa.Sequence: MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN… More details

$350 / 0.05 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HBsAg preS2, Recombinant Protein

Full Product Name

HBsAg preS2, Hepatitis B Surface Antigen (55 aa)

Product Gene Name

HBsAg recombinant protein

Product Synonym Names

HBsAg preS2 recombinant protein; HBsAg preS2 Recombinant Protein; HBsAg preS2 Recombinant Protein

Host

E Coli.

Form/Format

20 mM PB, 50 mM NaCl (pH7.4).

Purity/Purification

>95% (by SDS-PAGE)
Purified by proprietary chromatographic technique

Concentration

1 ug/ul (lot specific)

Preparation and Storage

Store at 4°C but should be kept at -20°C for long term storage. Non-hazardous.

Product Categories/Family for HBsAg recombinant protein

Viral Recombinant Proteins; Hepatitis Virus

Applications Tested/Suitable for HBsAg recombinant protein

Western Blot (WB), ELISA (EIA)

Application Notes for HBsAg recombinant protein

Immunochromatography, antibody ELISA, antigen, etc.

Other Notes

Small volumes of HBsAg recombinant protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HBsAg purchase

MBS434108 is a recombinant protein targeting HBsAg. Also known as HBsAg preS2, Hepatitis B Surface Antigen (55 aa). Host: E Coli.

Hbsag Pres2 (HBsAg) Recombinant Protein

Product Overview

Product Categories/Family for HBsAg recombinant protein

Related Product Information for HBsAg recombinant protein

Other Notes

Searchable Terms for HBsAg purchase