Mouse Anti-TMEM16A Monoclonal Antibody – Cat# MBS438470

Formalin-fixed, paraffin-embedded human GIST stained with DOG1 Monoclonal Antibody (DG1/447 + DOG1.1).

DOG-1 / TMEM16A / ANO1 (TMEM16A) Antibody – Mouse Monoclonal

Name: TMEM16A Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS438470
Price: 280 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS438470

MBS438470 is an antibody targeting TMEM16A. Also known as DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Mouse Monoclonal Antibody. Reactive in Human. Host: Mouse. More details

$280 / 0.02 mg (With BSA & Azide at 0.2mg/mL) +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

DOG-1 / TMEM16A / ANO1, Monoclonal Antibody

Full Product Name

DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Mouse Monoclonal Antibody

Product Gene Name

anti-TMEM16A antibody

Product Synonym Names

Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A

Clonality

Monoclonal

Isotype

IgG

Clone Number

DG1/447 + DOG-1.1

Host

Mouse

Species Reactivity

Human

Form/Format

200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Specificity

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

Preparation and Storage

Antibody with azide - store at 2 to 8 degree C. Antibody without azide - store at -20 to -80 degree C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Molecular Weight

~114kDa

OMIM

610108

3D Structure

ModBase 3D Structure for Q5XXA6

Cellular Localization

Cell Surface and Cytoplasm

Immunogen

Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).

Hu-Chromosome Location

11q13.3

Positive Control

Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

Applications Tested/Suitable for anti-TMEM16A antibody

Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC) Formalin

Application Notes for anti-TMEM16A antibody

Flow Cytometry (0.5-1ug/million cells in 0.1ml)
Immunofluorescence (0.5-1ug/ml)
Immunohistochemistry (Formalin-fixed) (0.25-0.5ug/ml for 30 minutes at RT) (Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes)

Product References and Citations for anti-TMEM16A antibody

Espinosa I, et. al. Am J Surg Pathol 2008;32:210-218.

Other Notes

Small volumes of anti-TMEM16A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TMEM16A. It may not necessarily be applicable to this product.

NCBI GI #

194306539

NCBI GeneID

55107

NCBI Accession #

NP_060513.5

UniProt Primary Accession #

Q5XXA6

UniProt Secondary Accession #

Q8IYY8; Q8N7V3; A8KAM3

UniProt Related Accession #

Q5XXA6

GenBank Nucleotide #

NM_018043.5

NCBI Official Full Name

anoctamin-1

NCBI Official Synonym Full Names

anoctamin 1

NCBI Official Symbol

ANO1

NCBI Official Synonym Symbols

DOG1; TAOS2; ORAOV2; TMEM16A

UniProt Protein Name

Anoctamin-1

UniProt Synonym Protein Names

Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2

UniProt Gene Name

ANO1

UniProt Synonym Gene Names

DOG1; ORAOV2; TAOS2; TMEM16A

UniProt Entry Name

ANO1_HUMAN

NCBI Protein Information

anoctamin-1

UniProt Comments for TMEM16A

ANO1: Acts as a calcium-activated chloride channel. Required for normal tracheal development. Belongs to the anoctamin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ion channel; Transporter; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: apical plasma membrane; plasma membrane

Molecular Function: calcium activated cation channel activity; chloride channel activity; intracellular calcium activated chloride channel activity; iodide transmembrane transporter activity; protein binding; voltage-gated chloride channel activity

Biological Process: cation transport; chloride transport; detection of temperature stimulus involved in sensory perception of pain; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); iodide transport

Research Articles on TMEM16A

1. Anoctamin and pendrin are two plausible candidates as mediators of apical iodide efflux--{review}

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-TMEM16A antibody

Products by Pathway	Pathway Diagram
Ion Channel Transport Pathway antibodies	Ion Channel Transport Pathway Diagram
Stimuli-sensing Channels Pathway antibodies	Stimuli-sensing Channels Pathway Diagram
Transmembrane Transport Of Small Molecules Pathway antibodies	Transmembrane Transport Of Small Molecules Pathway Diagram

Diseases associated with anti-TMEM16A antibody

Disease Name	Pubmed Publications
Fibrosis Antibodies	>47 publications with TMEM16A and Fibrosis
Lung Diseases Antibodies	>21 publications with TMEM16A and Lung Diseases
Adenocarcinoma Antibodies	>13 publications with TMEM16A and Adenocarcinoma
Inflammation Antibodies	>10 publications with TMEM16A and Inflammation
Disease Models, Animal Antibodies	>9 publications with TMEM16A and Disease Models, Animal
Cardiovascular Diseases Antibodies	>9 publications with TMEM16A and Cardiovascular Diseases
Breast Neoplasms Antibodies	>8 publications with TMEM16A and Breast Neoplasms
Kidney Diseases Antibodies	>6 publications with TMEM16A and Kidney Diseases
Uterine Neoplasms Antibodies	>5 publications with TMEM16A and Uterine Neoplasms
Neoplasm Invasiveness Antibodies	>5 publications with TMEM16A and Neoplasm Invasiveness

Organs/Tissues associated with anti-TMEM16A antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>94 publications with TMEM16A and Muscle
Intestine Antibodies	>34 publications with TMEM16A and Intestine
Vascular Antibodies	>29 publications with TMEM16A and Vascular
Stomach Antibodies	>23 publications with TMEM16A and Stomach
Lung Antibodies	>21 publications with TMEM16A and Lung
Brain Antibodies	>19 publications with TMEM16A and Brain
Kidney Antibodies	>17 publications with TMEM16A and Kidney
Salivary Gland Antibodies	>16 publications with TMEM16A and Salivary Gland
Mouth Antibodies	>12 publications with TMEM16A and Mouth
Eye Antibodies	>11 publications with TMEM16A and Eye