Rabbit Anti-TSSK2 Polyclonal Antibody – Cat# MBS5301257

TSSK2 antibody (MBS5301257) used at 1 ug/ml to detect target protein.

TSSK2 Antibody – Rabbit Polyclonal

Name: TSSK2 Antibody; Polyclonal; Rabbit; MyBioSource
Brand: MyBioSource
SKU: MBS5301257
Price: 1120 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS5301257

MBS5301257 is an antibody targeting TSSK2. Also known as TSSK2 antibody. Host: Rabbit. Rabbit polyclonal TSSK2 antibody raised against the middle region of TSSK2 More details

$1120 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TSSK2, Polyclonal Antibody

Full Product Name

TSSK2 antibody

Product Gene Name

anti-TSSK2 antibody

Product Synonym Names

Polyclonal TSSK2; Anti-TSSK2; FLJ38613; TSSK2; TSSK-2; TSSK 2; DGS-G; SPOGA2; Testis-Specific Serine Kinase 2; STK22B

Clonality

Polyclonal

Host

Rabbit

Form/Format

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSSK2 antibody in PBS

Purity/Purification

Affinity purified

Concentration

1 mg/ml (lot specific)

Specificity

TSSK2 antibody was raised against the middle region of TSSK2

Preparation and Storage

Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Molecular Weight

39 kDa (MW of target protein)

OMIM

610710

Cross-Reactivity

Human, Mouse, Rat

Immunogen

TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Product Categories/Family for anti-TSSK2 antibody

Differentiation & Development; Purified Polyclonal Antibodies

Applications Tested/Suitable for anti-TSSK2 antibody

Western Blot (WB)

Application Notes for anti-TSSK2 antibody

WB: 1 ug/ml

Other Notes

Small volumes of anti-TSSK2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TSSK2. It may not necessarily be applicable to this product.

NCBI GI #

194294513

NCBI GeneID

23617

NCBI Accession #

NP_443732.3

UniProt Secondary Accession #

Q8IY55

UniProt Related Accession #

Q96PF2

GenBank Nucleotide #

NM_053006.4

NCBI Official Full Name

testis-specific serine/threonine-protein kinase 2

NCBI Official Synonym Full Names

testis-specific serine kinase 2

NCBI Official Symbol

TSSK2

NCBI Official Synonym Symbols

TSK2; DGS-G; SPOGA2; STK22B

UniProt Protein Name

Testis-specific serine/threonine-protein kinase 2

UniProt Synonym Protein Names

DiGeorge syndrome protein G; DGS-G; Serine/threonine-protein kinase 22B

Protein Family

Testis-specific serine/threonine-protein kinase

UniProt Gene Name

TSSK2

UniProt Synonym Gene Names

DGSG; SPOGA2; STK22B; TSK-2; TSK2; TSSK-2; Testis-specific kinase 2; DGS-G

UniProt Entry Name

TSSK2_HUMAN

NCBI Protein Information

testis-specific serine/threonine-protein kinase 2

NCBI Summary for TSSK2

TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]

UniProt Comments for TSSK2

TSSK2: Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at 'Ser-288' and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.

Protein type: Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; CAMK group; TSSK family

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: centriole; cytoplasm; acrosome; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; magnesium ion binding; ATP binding

Biological Process: multicellular organismal development; protein amino acid autophosphorylation; protein amino acid phosphorylation; spermatid development

Research Articles on TSSK2

1. Report evolution of testis-specific kinases TSSK1B and TSSK2 in primates.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-TSSK2 antibody

Reference Product	PubMed Publications
TSKS antibody	>5 publications with TSSK2 and TSKS

Diseases associated with anti-TSSK2 antibody

Disease Name	Pubmed Publications
Infertility, Female Antibodies	>1 publications with TSSK2 and Infertility, Female

Organs/Tissues associated with anti-TSSK2 antibody

Organ/Tissue Name	Pubmed Publications
Testis Antibodies	>12 publications with TSSK2 and Testis