Rabbit Anti-HS3ST6 Polyclonal Antibody – Cat# MBS5301806

HS3ST6 antibody (MBS5301806) used at 1 ug/ml to detect target protein.

HS3ST6 Antibody – Rabbit Polyclonal

Name: HS3ST6 Antibody; Polyclonal; Rabbit; MyBioSource
Brand: MyBioSource
SKU: MBS5301806
Price: 1120 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS5301806

MBS5301806 is an antibody targeting HS3ST6. Also known as HS3ST6 antibody. Reactive in Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish.. Host: Rabbit. Rabbit polyclonal HS3ST6 antibody More details

$1120 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HS3ST6, Polyclonal Antibody

Full Product Name

HS3ST6 antibody

Product Gene Name

anti-HS3ST6 antibody

Product Synonym Names

Polyclonal HS3ST6; Anti-HS3ST6; Heparan Sulfate; HS3ST5; Glucosamine 3-O-Sulfotransferase 6

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish.

Form/Format

Lyophilized powder. Reconstitute with 50 ul distilled water for a final concentration of 1mg/ml in PBS buffer with 2% sucrose.

Purity/Purification

Affinity purified

Concentration

50ug, lyophilized (lot specific)

Preparation and Storage

Ships ambient or refrigerated. Upon receipt store at 4 degree C short term, -20 degree C long term. Avoid repeat freeze-thaw cycles.

Molecular Weight

35 kDa (MW of target protein)

Cross-Reactivity

Human,Mouse,Rat

Immunogen

Synthetic peptide directed towards the C terminal region of human HS3ST6

Immunogen Information

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Product Categories/Family for anti-HS3ST6 antibody

Cell Biology; Purified Polyclonal Antibodies

Applications Tested/Suitable for anti-HS3ST6 antibody

Western Blot (WB)

Application Notes for anti-HS3ST6 antibody

WB: 1 ug/ml

Other Notes

Small volumes of anti-HS3ST6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HS3ST6. It may not necessarily be applicable to this product.

NCBI GI #

219519881

NCBI GeneID

328779

NCBI Accession #

AAI45425.1

UniProt Related Accession #

Q5GFD5

NCBI Official Full Name

Hs3st6 protein

NCBI Official Synonym Full Names

heparan sulfate (glucosamine) 3-O-sulfotransferase 6

NCBI Official Symbol

Hs3st6

UniProt Protein Name

Heparan sulfate glucosamine 3-O-sulfotransferase 6

UniProt Synonym Protein Names

Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 6; 3-OST-6; Heparan sulfate 3-O-sulfotransferase 6

Protein Family

Heparan sulfate glucosamine 3-O-sulfotransferase

UniProt Gene Name

Hs3st6

UniProt Synonym Gene Names

3-OST-6; Heparan sulfate 3-O-sulfotransferase 6

UniProt Entry Name

HS3S6_MOUSE

NCBI Protein Information

heparan sulfate glucosamine 3-O-sulfotransferase 6

UniProt Comments for HS3ST6

HS3ST6: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3- OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate. Belongs to the sulfotransferase 1 family.

Protein type: EC 2.8.2.23; Transferase; Membrane protein, integral

Cellular Component: Golgi apparatus; membrane; integral to membrane

Molecular Function: phenanthrol sulfotransferase activity; trans-3,4-dihydrodiolphenanthrene sulfotransferase activity; proteoglycan sulfotransferase activity; 2-phenanthrol sulfotransferase activity; galactose 3-O-sulfotransferase activity; transferase activity; 1-phenanthrol sulfotransferase activity; sulfotransferase activity; 3-phenanthrol sulfotransferase activity; HNK-1 sulfotransferase activity; N-acetylglucosamine 6-O-sulfotransferase activity; 4-phenanthrol sulfotransferase activity; trans-9R,10R-dihydrodiolphenanthrene sulfotransferase activity; heparan sulfate 2-O-sulfotransferase activity; cholesterol sulfotransferase activity; N-acetylgalactosamine 4-O-sulfotransferase activity; heparin-glucosamine 3-O-sulfotransferase activity; 9-phenanthrol sulfotransferase activity; heparan sulfate 6-O-sulfotransferase activity

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HS3ST6 antibody

Reference Product	PubMed Publications
Hs2st1 antibody	>1 publications with HS3ST6 and Hs2st1

Pathways associated with anti-HS3ST6 antibody

Products by Pathway	Pathway Diagram
Metapathway Biotransformation antibodies	Metapathway Biotransformation Diagram
Heparan Sulfate Biosynthesis Pathway antibodies	Heparan Sulfate Biosynthesis Pathway Diagram
Heparan Sulfate Biosynthesis (late Stages) Pathway antibodies	Heparan Sulfate Biosynthesis (late Stages) Pathway Diagram