• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

KIAA1189 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS5301889

Rabbit polyclonal KIAA1189 antibody raised against the middle region of Kiaa1189 More details

$1120 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
KIAA1189, Polyclonal Antibody
Full Product Name
KIAA1189 antibody
Product Gene Name
anti-KIAA1189 antibody
Product Synonym Names
Polyclonal KIAA1189; Anti-KIAA1189; KIAA 1189; KIAA1189; ermin; KIAA-1189
Clonality
Polyclonal
Host
Rabbit
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1189 antibody in PBS
Purity/Purification
Affinity purified
Concentration
1 mg/ml (lot specific)
Specificity
KIAA1189 antibody was raised against the middle region of Kiaa1189
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Molecular Weight
34 kDa (MW of target protein)
OMIM
610072
Cross-Reactivity
Human
Immunogen
KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Product Categories/Family for anti-KIAA1189 antibody

Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-KIAA1189 antibody
Western Blot (WB)
Application Notes for anti-KIAA1189 antibody
WB: 1 ug/ml

Western Blot (WB) of anti-KIAA1189 antibody

KIAA1189 antibody (MBS5301889) used at 1 ug/ml to detect target protein.
Rabbit Anti-KIAA1189 Polyclonal Antibody – Cat# MBS5301889

Other Notes

Small volumes of anti-KIAA1189 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KIAA1189 purchase

MBS5301889 is an antibody targeting KIAA1189. Also known as KIAA1189 antibody. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for KIAA1189. It may not necessarily be applicable to this product.

NCBI GI #
119631853
NCBI GeneID
57471
NCBI Accession #
EAX11448.1
UniProt Secondary Accession #
Q9ULN1; B4DKA6
UniProt Related Accession #
Q8TAM6
NCBI Official Full Name
KIAA1189
NCBI Official Synonym Full Names
ermin, ERM-like protein
NCBI Official Symbol
ERMN
NCBI Official Synonym Symbols
JN; ermin; KIAA1189
UniProt Protein Name
Ermin
UniProt Synonym Protein Names
Juxtanodin; JN
UniProt Gene Name
ERMN
UniProt Synonym Gene Names
KIAA1189; JN
UniProt Entry Name
ERMIN_HUMAN
NCBI Protein Information
ermin

UniProt Comments for KIAA1189

ERMN: Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: internode region of axon; cytoskeleton; cell soma; paranode region of axon; cytoplasm; cell cortex; myelin sheath; filopodium

Molecular Function: actin filament binding

Biological Process: regulation of cell shape; actin filament organization; morphogenesis of a branching structure; regulation of cell projection organization and biogenesis
Show more

Research Articles on KIAA1189

1. this study suggested a role for hErmin as a novel cytoskeleton-related oligodendroglial protein in human brain myelination and human epileptogenesis, and provide new evidence for the relationship between oligodendrocytes and epilepsy.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-KIAA1189 antibody

 Disease Name  Pubmed Publications
 Chromosome Aberrations Antibodies  >1 publications with KIAA1189 and Chromosome Aberrations
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000