Cecropin A TFA Inhibitor

Name: Cecropin A TFA Inhibitor; MyBioSource
Brand: MyBioSource
SKU: MBS5752897
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS5752897

Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity. More details

Please Inquire

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Cecropin A TFA, Inhibitor

Full Product Name

Cecropin A TFA

Form/Format

Solid. Powder

Purity/Purification

98.00%

Preparation and Storage

Store at -20 degree C for 3 years powder
-80 degree C for 2 years in solvent

Molecular Weight

4117.8

Solubility

H2O: 50mg/mL (12.14mM)
(<1mg/ml refers to the product slightly soluble or insoluble)

Formula

C186H314N53O48F3

SMILES

FC(F)(F)C(O)=O.[KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2]

Target & IC50

Others

Product References and Citations for Cecropin A TFA, inhibitor

Ceron JM, et al. The antimicrobial peptide cecropin A induces caspase-independent cell death in human promyelocytic leukemia cells. Peptides. 2010 Aug;31(8):1494-503.
Ceron JM, et al. The antimicrobial peptide cecropin A induces caspase-independent cell death in human promyelocytic leukemia cells. Peptides. 2010 Aug;31(8):1494-503.
Lee E, et al. Anti-inflammatory activities of cecropin A and its mechanism of action. Arch Insect Biochem Physiol. 2015 Jan;88(1):31-44.
Lee E, et al. Anti-inflammatory activities of cecropin A and its mechanism of action. Arch Insect Biochem Physiol. 2015 Jan;88(1):31-44.

Other Notes

Small volumes of Cecropin A TFA, inhibitor vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Cecropin A TFA purchase

MBS5752897 is an inhibitor targeting Cecropin A TFA.

Cecropin A TFA Inhibitor

Product Overview

Related Product Information for Cecropin A TFA, inhibitor

Product References and Citations for Cecropin A TFA, inhibitor

Other Notes

Searchable Terms for Cecropin A TFA purchase