Mouse Anti-AGO4 Monoclonal Antibody – Cat# MBS6129911

Detection limit for recombinant GST tagged EIF2C4 is 3ng/ml as a capture antibody

AGO4 Antibody – Mouse Monoclonal

Name: AGO4 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6129911
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6129911

AGO4 also known as EIF2C4 is involved in regulation of gene silencing via small RNA's such as siRNA and miRNA. This protein contains both a PAZ and a PIWI domain characteristic of Argonaute family of proteins. Functionally Ago4 is the catalytic component of… More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

AGO4, Monoclonal Antibody

Full Product Name

AGO4 (Protein Argonaute-4, Argonaute4, hAgo4, Eukaryotic Translation Initiation Factor 2C 4, eIF-2C 4, eIF2C 4, EIF2C4, AGO4, KIAA1567) (AP)

Product Gene Name

anti-AGO4 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4G3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human EIF2C4.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

97,097 Da

OMIM

607356

3D Structure

ModBase 3D Structure for Q9HCK5

Immunogen

Partial recombinant protein corresponding to aa1-101 from human EIF2C4 (NP_060099) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGR

Conjugate

Product Categories/Family for anti-AGO4 antibody

Antibodies; Translation Initiation Factors

Applications Tested/Suitable for anti-AGO4 antibody

ELISA (EIA)

Application Notes for anti-AGO4 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-AGO4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AGO4 purchase

MBS6129911 is an antibody targeting AGO4. Also known as AGO4 (Protein Argonaute-4, Argonaute4, hAgo4, Eukaryotic Translation Initiation Factor 2C 4, eIF-2C 4, eIF2C 4, EIF2C4, AGO4, KIAA1567) (AP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for AGO4. It may not necessarily be applicable to this product.

NCBI GI #

29029593

NCBI GeneID

192670

NCBI Accession #

NP_060099.2

UniProt Primary Accession #

Q9HCK5

UniProt Secondary Accession #

A7MD27

UniProt Related Accession #

Q9HCK5

GenBank Nucleotide #

NM_017629

NCBI Official Full Name

protein argonaute-4

NCBI Official Synonym Full Names

argonaute 4, RISC catalytic component

NCBI Official Symbol

AGO4

NCBI Official Synonym Symbols

EIF2C4

UniProt Protein Name

Protein argonaute-4

UniProt Synonym Protein Names

Argonaute RISC catalytic component 4; Eukaryotic translation initiation factor 2C 4

Protein Family

Protein argonaute

UniProt Gene Name

AGO4

UniProt Synonym Gene Names

EIF2C4; KIAA1567; Argonaute4; hAgo4; eIF-2C 4; eIF2C 4

UniProt Entry Name

AGO4_HUMAN

NCBI Protein Information

protein argonaute-4

NCBI Summary for AGO4

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1. [provided by RefSeq, Jul 2008]

UniProt Comments for AGO4

AGO4: Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for RNA-directed transcription and replication of the human hapatitis delta virus (HDV). Interacts with EIF4B, IMP8, PRMT5, TNRC6A and TNRC6B. Belongs to the argonaute family. Ago subfamily.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: cytoplasm; cytosol; membrane

Molecular Function: double-stranded RNA binding; miRNA binding; protein binding; single-stranded RNA binding

Biological Process: miRNA-mediated gene silencing, miRNA loading onto RISC; miRNA-mediated gene silencing, mRNA cleavage; miRNA-mediated gene silencing, negative regulation of translation; miRNA-mediated gene silencing, production of miRNAs; mRNA catabolic process; phosphoinositide-mediated signaling; pre-microRNA processing; RNA secondary structure unwinding; RNA-mediated posttranscriptional gene silencing; Wnt receptor signaling pathway, calcium modulating pathway

Research Articles on AGO4

1. Chimeras with Ago4 N-terminal domains were defective in RISC activation & sometimes also in RNA loading. This highlights the pleiotropic role of the Ago N domain & emphasizes the unique position of human Ago4 within the Ago protein family.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-AGO4 antibody

Reference Product	PubMed Publications
EIF2C2 antibody	>9 publications with AGO4 and EIF2C2
EIF2C4 antibody	>5 publications with AGO4 and EIF2C4
EIF2C3 antibody	>4 publications with AGO4 and EIF2C3
MOV10 antibody	>2 publications with AGO4 and MOV10
TARBP2 antibody	>2 publications with AGO4 and TARBP2
TNRC6B antibody	>2 publications with AGO4 and TNRC6B
TNRC6A antibody	>2 publications with AGO4 and TNRC6A
TNRC6C antibody	>1 publications with AGO4 and TNRC6C
DICER1 antibody	>1 publications with AGO4 and DICER1

Pathways associated with anti-AGO4 antibody

Products by Pathway	Pathway Diagram
Adaptive Immune System Pathway antibodies	Adaptive Immune System Pathway Diagram
Beta-catenin Independent WNT Signaling Pathway antibodies	Beta-catenin Independent WNT Signaling Pathway Diagram
Ca2+ Pathway antibodies	Ca2+ Pathway Diagram
Cellular Senescence Pathway antibodies	Cellular Senescence Pathway Diagram
Cellular Responses To Stress Pathway antibodies	Cellular Responses To Stress Pathway Diagram
DAP12 Interactions Pathway antibodies	DAP12 Interactions Pathway Diagram
DAP12 Signaling Pathway antibodies	DAP12 Signaling Pathway Diagram
Downstream Signal Transduction Pathway antibodies	Downstream Signal Transduction Pathway Diagram
Downstream Signaling Events Of B Cell Receptor (BCR) Pathway antibodies	Downstream Signaling Events Of B Cell Receptor (BCR) Pathway Diagram
Downstream Signaling Of Activated FGFR1 Pathway antibodies	Downstream Signaling Of Activated FGFR1 Pathway Diagram

Diseases associated with anti-AGO4 antibody

Disease Name	Pubmed Publications
Breast Neoplasms Antibodies	>2 publications with AGO4 and Breast Neoplasms
Lung Diseases Antibodies	>1 publications with AGO4 and Lung Diseases
Carcinoma, Hepatocellular Antibodies	>1 publications with AGO4 and Carcinoma, Hepatocellular
Inflammation Antibodies	>1 publications with AGO4 and Inflammation
Liver Diseases Antibodies	>1 publications with AGO4 and Liver Diseases
Liver Neoplasms Antibodies	>1 publications with AGO4 and Liver Neoplasms

Organs/Tissues associated with anti-AGO4 antibody

Organ/Tissue Name	Pubmed Publications
Testis Antibodies	>2 publications with AGO4 and Testis
Blood Antibodies	>1 publications with AGO4 and Blood
Embryonic Tissue Antibodies	>1 publications with AGO4 and Embryonic Tissue
Placenta Antibodies	>1 publications with AGO4 and Placenta
Liver Antibodies	>1 publications with AGO4 and Liver
Brain Antibodies	>1 publications with AGO4 and Brain