• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ARID3A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6130056

MBS6130056 is an antibody targeting ARID3A. Also known as ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1,… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ARID3A, Monoclonal Antibody
Full Product Name
ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1) (AP)
Product Gene Name
anti-ARID3A antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ARID3A.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
62,889 Da
OMIM
603265
3D Structure
ModBase 3D Structure for Q99856
Immunogen
Partial recombinant corresponding to aa317-416 from human ARID3A (NP_005215) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Conjugate
AP

Product Categories/Family for anti-ARID3A antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-ARID3A antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-ARID3A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ARID3A antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-ARID3A Monoclonal Antibody – Cat# MBS6130056

Western Blot (WB) of anti-ARID3A antibody

ARID3A monoclonal antibody, Western Blot analysis of ARID3A expression in K-562.
Mouse Anti-ARID3A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6130056

Immunohistochemistry (IHC) of anti-ARID3A antibody

Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].
Mouse Anti-ARID3A Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6130056

Immunofluorescence (IF) of anti-ARID3A antibody

Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-ARID3A Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6130056

Testing Data of anti-ARID3A antibody

Detection limit for recombinant GST tagged ARID3A is ~0.03ng/ml as a capture antibody.
Mouse Anti-ARID3A Monoclonal Antibody, Testing Data – Cat# MBS6130056

Western Blot (WB) of anti-ARID3A antibody

Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-ARID3A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6130056

Product References and Citations for anti-ARID3A antibody

1. Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry. Kang UB, Yeom J, Kim HJ, Kim H, Lee C.J Proteomics. 2011 Nov 26.

Other Notes

Small volumes of anti-ARID3A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ARID3A. It may not necessarily be applicable to this product.

NCBI GI #
4885193
NCBI GeneID
1820
NCBI Accession #
NP_005215
UniProt Primary Accession #
Q99856
UniProt Secondary Accession #
Q5I858; Q6P9C6; Q8IZA7; Q8N4Z3
UniProt Related Accession #
Q99856
GenBank Nucleotide #
NM_005224
NCBI Official Full Name
AT-rich interactive domain-containing protein 3A
NCBI Official Synonym Full Names
AT rich interactive domain 3A (BRIGHT-like)
NCBI Official Symbol
ARID3A
NCBI Official Synonym Symbols
DRIL1; DRIL3; BRIGHT; E2FBP1
UniProt Protein Name
AT-rich interactive domain-containing protein 3A
UniProt Synonym Protein Names
B-cell regulator of IgH transcription; Bright; Dead ringer-like protein 1; E2F-binding protein 1
Protein Family
AT-rich interactive domain-containing protein
UniProt Gene Name
ARID3A
UniProt Synonym Gene Names
DRIL1; DRIL3; DRX; E2FBP1; ARID domain-containing protein 3A; Bright
UniProt Entry Name
ARI3A_HUMAN
NCBI Protein Information
AT-rich interactive domain-containing protein 3A; ARID domain-containing 3A; ARID domain-containing protein 3A; AT rich interactive domain 3A (BRIGHT- like) protein; B-cell regulator of IgH transcription; E2F-binding protein 1; dead ringer-like 1; dead ri

UniProt Comments for ARID3A

Bright: a member of the ARID (AT-rich interaction domain) family of transcription factors. It was found by its homology to the Drosophila dead ringer protein, which is important for normal embryogenesis. Binds a VH promoter proximal site necessary for induced mu-heavy-chain transcription. Binds the minor groove of a restricted ATC sequence that is sufficient for nuclear matrix association. This sequence motif is present in matrix-associating regions (MARS) proximal to the promoter and flanking E mu. Activates E mu-driven transcription by binding these sites. Contributes to localized control of accessibility and therefore nonrandom gene use during V(D)J recombination.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; nucleolus; lipid raft

Molecular Function: protein binding; protein homodimerization activity; chromatin binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ARID3A antibody

 Reference Product  PubMed Publications
 BTK antibody  >6 publications with ARID3A and BTK
 PML antibody  >4 publications with ARID3A and PML
 SP100 antibody  >1 publications with ARID3A and SP100
 SUMO1 antibody  >1 publications with ARID3A and SUMO1
 SP140 antibody  >1 publications with ARID3A and SP140
 TP53 antibody  >1 publications with ARID3A and TP53

Pathways associated with anti-ARID3A antibody

 Products by Pathway  Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram

Diseases associated with anti-ARID3A antibody

 Disease Name  Pubmed Publications
 Translocation, Genetic Antibodies  >1 publications with ARID3A and Translocation, Genetic
 Brain Diseases Antibodies  >1 publications with ARID3A and Brain Diseases
 Kidney Diseases Antibodies  >1 publications with ARID3A and Kidney Diseases

Organs/Tissues associated with anti-ARID3A antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >3 publications with ARID3A and Bone
 Lymph Node Antibodies  >2 publications with ARID3A and Lymph Node
 Embryonic Tissue Antibodies  >2 publications with ARID3A and Embryonic Tissue
 Ovary Antibodies  >1 publications with ARID3A and Ovary
 Liver Antibodies  >1 publications with ARID3A and Liver
 Kidney Antibodies  >1 publications with ARID3A and Kidney
 Placenta Antibodies  >1 publications with ARID3A and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000