• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CDADC1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6130487

MBS6130487 is an antibody targeting CDADC1. Also known as CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) (AP). Reactive in Human, Mouse. Host: Mouse. More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CDADC1, Monoclonal Antibody
Full Product Name
CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) (AP)
Product Gene Name
anti-CDADC1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A2
Host
Mouse
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CDADC1. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
57kDa
3D Structure
ModBase 3D Structure for Q9BWV3
Immunogen
Partial recombinant corresponding to aa423-515 from human CDADC1 (NP_112173) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
Conjugate
AP

Product Categories/Family for anti-CDADC1 antibody

Antibodies; Enzymes; Cytidine Deaminase (APOBEC)
Applications Tested/Suitable for anti-CDADC1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-CDADC1 antibody
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CDADC1 antibody

Western Blot detection against Immunogen (36.23kD).
Mouse Anti-CDADC1 Monoclonal Antibody – Cat# MBS6130487

Western Blot (WB) of anti-CDADC1 antibody

Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody. Lane 1: CDADC1 transfected lysate (58.5kD). Lane 2: Non-transfected lysate.
Mouse Anti-CDADC1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6130487

Immunohistochemistry (IHC) of anti-CDADC1 antibody

Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].
Mouse Anti-CDADC1 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6130487

Testing Data of anti-CDADC1 antibody

Detection limit for recombinant GST tagged CDADC1 is ~0.03ng/ml as a capture antibody.
Mouse Anti-CDADC1 Monoclonal Antibody, Testing Data – Cat# MBS6130487

Western Blot (WB) of anti-CDADC1 antibody

Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-CDADC1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6130487

Western Blot (WB) of anti-CDADC1 antibody

CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in Raw 264.7.
Mouse Anti-CDADC1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6130487

Western Blot (WB) of anti-CDADC1 antibody

CDADC1 monoclonal antibody. Western Blot analysis of CDADC1 expression in NIH/3T3.
Mouse Anti-CDADC1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6130487

Other Notes

Small volumes of anti-CDADC1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CDADC1. It may not necessarily be applicable to this product.

NCBI GI #
13569864
NCBI GeneID
81602
NCBI Accession #
NP_112173
UniProt Primary Accession #
Q9BWV3
UniProt Related Accession #
Q9BWV3
GenBank Nucleotide #
NM_030911
NCBI Official Full Name
cytidine and dCMP deaminase domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
cytidine and dCMP deaminase domain containing 1
NCBI Official Symbol
CDADC1
NCBI Official Synonym Symbols
NYD-SP15; bA103J18.1
UniProt Protein Name
Cytidine and dCMP deaminase domain-containing protein 1
UniProt Synonym Protein Names
Testis development protein NYD-SP15
Protein Family
Cytidine and dCMP deaminase domain-containing protein
UniProt Gene Name
CDADC1
UniProt Entry Name
CDAC1_HUMAN
NCBI Protein Information
cytidine and dCMP deaminase domain-containing protein 1

Research Articles on CDADC1

1. NYD-SP15 contained nuclear localization sequence and nuclear export-signal and could dynamically shuttle between the nucleus and cytoplasm.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Organs/Tissues associated with anti-CDADC1 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >1 publications with CDADC1 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000