• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ID3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6131796

MBS6131796 is an antibody targeting ID3. Also known as ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3)… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ID3, Monoclonal Antibody
Full Product Name
ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (AP)
Product Gene Name
anti-ID3 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ID3.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
12,999 Da
OMIM
600277
3D Structure
ModBase 3D Structure for Q02535
Immunogen
Partial recombinant corresponding to aa1-83 form human ID3 (NP_002158) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Conjugate
AP

Product Categories/Family for anti-ID3 antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-ID3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-ID3 antibody
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ID3 antibody

Western Blot detection against Immunogen (34.87kD).
Mouse Anti-ID3 Monoclonal Antibody – Cat# MBS6131796

Western Blot (WB) of anti-ID3 antibody

ID3 monoclonal antibody Western Blot analysis of ID3 expression in HeLa.
Mouse Anti-ID3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6131796

Testing Data of anti-ID3 antibody

Detection limit for recombinant GST tagged ID3 is ~0.03ng/ml as a capture antibody.
Mouse Anti-ID3 Monoclonal Antibody, Testing Data – Cat# MBS6131796

Western Blot (WB) of anti-ID3 antibody

Western blot analysis of ID3 over-expressed 293 cell line, cotransfected with ID3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ID3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-ID3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6131796

Other Notes

Small volumes of anti-ID3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ID3. It may not necessarily be applicable to this product.

NCBI GI #
156119621
NCBI GeneID
3399
NCBI Accession #
NP_002158
UniProt Primary Accession #
Q02535
UniProt Secondary Accession #
O75641; A8K1T8
UniProt Related Accession #
Q02535
GenBank Nucleotide #
NM_002167
NCBI Official Full Name
DNA-binding protein inhibitor ID-3
NCBI Official Synonym Full Names
inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
NCBI Official Symbol
ID3
NCBI Official Synonym Symbols
HEIR-1; bHLHb25
UniProt Protein Name
DNA-binding protein inhibitor ID-3
UniProt Synonym Protein Names
Class B basic helix-loop-helix protein 25; bHLHb25; Helix-loop-helix protein HEIR-1; ID-like protein inhibitor HLH 1R21; Inhibitor of DNA binding 3
Protein Family
DNA-binding protein inhibitor
UniProt Gene Name
ID3
UniProt Synonym Gene Names
1R21; BHLHB25; HEIR1
UniProt Entry Name
ID3_HUMAN
NCBI Protein Information
DNA-binding protein inhibitor ID-3

NCBI Summary for ID3

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011]

UniProt Comments for ID3

ID3: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors. Induced by phorbol 12-myristate 13-acetate (PMA). Interacts with COPS5 and COPS7A. Homodimer, and heterodimer with other HLH proteins.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 1p36.13-p36.12

Cellular Component: microtubule cytoskeleton; nucleoplasm; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein domain specific binding; protein binding; transcription factor binding; transcription factor activity; transcription corepressor activity

Biological Process: circadian rhythm; muscle development; central nervous system development; transcription, DNA-dependent; positive regulation of apoptosis; regulation of cell cycle; heart development; multicellular organismal development; negative regulation of transcription factor activity; negative regulation of transcription from RNA polymerase II promoter; notochord development; neuron differentiation; odontogenesis; epithelial cell differentiation; response to wounding; negative regulation of osteoblast differentiation; negative regulation of myoblast differentiation; negative regulation of transcription, DNA-dependent; metanephros development; regulation of DNA replication
Show more

Research Articles on ID3

1. Epigenetic changes in ID3, in combination with experiences of maltreatment, may confer risk for depression in children.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ID3 antibody

 Reference Product  PubMed Publications
 TCF3 antibody  >39 publications with ID3 and TCF3
 BMP2 antibody  >16 publications with ID3 and BMP2
 TCF4 antibody  >6 publications with ID3 and TCF4
 CDK2 antibody  >3 publications with ID3 and CDK2
 VEGFA antibody  >3 publications with ID3 and VEGFA
 MYOD1 antibody  >3 publications with ID3 and MYOD1

Pathways associated with anti-ID3 antibody

 Products by Pathway  Pathway Diagram
 Adipogenesis Pathway antibodies  Adipogenesis Pathway Diagram
 Id Signaling Pathway antibodies  Id Signaling Pathway Diagram
 Signaling Pathways Regulating Pluripotency Of Stem Cells antibodies  Signaling Pathways Regulating Pluripotency Of Stem Cells Diagram
 Signaling Pathways Regulating Pluripotency Of Stem Cells antibodies  Signaling Pathways Regulating Pluripotency Of Stem Cells Diagram
 TGF-beta Signaling Pathway antibodies  TGF-beta Signaling Pathway Diagram
 TGF-beta Signaling Pathway antibodies  TGF-beta Signaling Pathway Diagram

Diseases associated with anti-ID3 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >34 publications with ID3 and Carcinoma
 Nervous System Diseases Antibodies  >23 publications with ID3 and Nervous System Diseases
 Brain Diseases Antibodies  >21 publications with ID3 and Brain Diseases
 Cardiovascular Diseases Antibodies  >21 publications with ID3 and Cardiovascular Diseases
 Neoplasms, Experimental Antibodies  >20 publications with ID3 and Neoplasms, Experimental
 Breast Neoplasms Antibodies  >17 publications with ID3 and Breast Neoplasms
 Prostatic Neoplasms Antibodies  >17 publications with ID3 and Prostatic Neoplasms
 Adenocarcinoma Antibodies  >17 publications with ID3 and Adenocarcinoma
 Inflammation Antibodies  >14 publications with ID3 and Inflammation
 Burkitt Lymphoma Antibodies  >14 publications with ID3 and Burkitt Lymphoma

Organs/Tissues associated with anti-ID3 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >128 publications with ID3 and Blood
 Bone Antibodies  >98 publications with ID3 and Bone
 Muscle Antibodies  >73 publications with ID3 and Muscle
 Vascular Antibodies  >56 publications with ID3 and Vascular
 Brain Antibodies  >53 publications with ID3 and Brain
 Embryonic Tissue Antibodies  >46 publications with ID3 and Embryonic Tissue
 Lung Antibodies  >29 publications with ID3 and Lung
 Thymus Antibodies  >28 publications with ID3 and Thymus
 Nerve Antibodies  >25 publications with ID3 and Nerve
 Bone Marrow Antibodies  >24 publications with ID3 and Bone Marrow
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000