• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NDUFA9 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6132517

MBS6132517 is an antibody targeting NDUFA9. Also known as NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (AP). Reactive in Human,… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NDUFA9, Monoclonal Antibody
Full Product Name
NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (AP)
Product Gene Name
anti-NDUFA9 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D7
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NDUFA9. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
42kDa
OMIM
603834
3D Structure
ModBase 3D Structure for Q16795
Immunogen
Partial recombinant corresponding to aa303-377 from human NDUFA9 (NP_004993) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
Conjugate
AP

Product Categories/Family for anti-NDUFA9 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-NDUFA9 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-NDUFA9 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NDUFA9 antibody

Western Blot detection against Immunogen (33.99kD).
Mouse Anti-NDUFA9 Monoclonal Antibody – Cat# MBS6132517

Western Blot (WB) of anti-NDUFA9 antibody

NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in PC-12.
Mouse Anti-NDUFA9 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6132517

Western Blot (WB) of anti-NDUFA9 antibody

NDUFA9 monoclonal antibody. Western Blot analysis of NDUFA9 expression in Raw 264.7.
Mouse Anti-NDUFA9 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6132517

Western Blot (WB) of anti-NDUFA9 antibody

NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in NIH/3T3.
Mouse Anti-NDUFA9 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6132517

Immunohistochemistry (IHC) of anti-NDUFA9 antibody

Immunoperoxidase of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8ug/ml]
Mouse Anti-NDUFA9 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6132517

Immunofluorescence (IF) of anti-NDUFA9 antibody

Immunofluorescence of monoclonal antibody to NDUFA9 on NIH/3T3 cell. [antibody concentration 10ug/ml]
Mouse Anti-NDUFA9 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6132517

Testing Data of anti-NDUFA9 antibody

Detection limit for recombinant GST tagged NDUFA9 is ~0.1ng/ml as a capture antibody.
Mouse Anti-NDUFA9 Monoclonal Antibody, Testing Data – Cat# MBS6132517

Other Notes

Small volumes of anti-NDUFA9 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for NDUFA9. It may not necessarily be applicable to this product.

NCBI GI #
6681764
NCBI GeneID
4704
NCBI Accession #
NP_004993
UniProt Primary Accession #
Q16795
UniProt Related Accession #
Q16795
GenBank Nucleotide #
NM_005002
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A9
NCBI Official Symbol
NDUFA9
NCBI Official Synonym Symbols
CC6; CI39k; CI-39k; MC1DN26; NDUFS2L; SDR22E1
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
UniProt Synonym Protein Names
Complex I-39kD; CI-39kD; NADH-ubiquinone oxidoreductase 39 kDa subunit
UniProt Gene Name
NDUFA9
UniProt Synonym Gene Names
NDUFS2L; CI-39kD
UniProt Entry Name
NDUA9_HUMAN
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

NCBI Summary for NDUFA9

The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. [provided by RefSeq, May 2010]
Show more

UniProt Comments for NDUFA9

NUEM: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFA9 subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; Mitochondrial; EC 1.6.99.3; Oxidoreductase

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: mitochondrial matrix; mitochondrial inner membrane; mitochondrial membrane; nucleus; mitochondrial respiratory chain complex I

Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity; protein complex binding; coenzyme binding; NADH dehydrogenase activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone; sodium ion transport

Disease: Leigh Syndrome
Show more

Research Articles on NDUFA9

1. NDUFA9 protein is essential for stabilizing the junction between membrane and matrix arms of complex I.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-NDUFA9 antibody

 Products by Pathway  Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Electron Transport Chain Pathway antibodies  Electron Transport Chain Pathway Diagram
 Huntington's Disease Pathway antibodies  Huntington's Disease Pathway Diagram
 Huntington's Disease Pathway antibodies  Huntington's Disease Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway antibodies  NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway Diagram
 Oxidative Phosphorylation Pathway antibodies  Oxidative Phosphorylation Pathway Diagram
 Oxidative Phosphorylation Pathway antibodies  Oxidative Phosphorylation Pathway Diagram
 Oxidative Phosphorylation Pathway antibodies  Oxidative Phosphorylation Pathway Diagram

Diseases associated with anti-NDUFA9 antibody

 Disease Name  Pubmed Publications
 Mitochondrial Diseases Antibodies  >3 publications with NDUFA9 and Mitochondrial Diseases
 Neoplasms Antibodies  >2 publications with NDUFA9 and Neoplasms
 Nervous System Diseases Antibodies  >2 publications with NDUFA9 and Nervous System Diseases
 Weight Gain Antibodies  >1 publications with NDUFA9 and Weight Gain
 Carcinoma, Hepatocellular Antibodies  >1 publications with NDUFA9 and Carcinoma, Hepatocellular
 Cardiovascular Diseases Antibodies  >1 publications with NDUFA9 and Cardiovascular Diseases
 Liver Diseases Antibodies  >1 publications with NDUFA9 and Liver Diseases
 Adenocarcinoma Antibodies  >1 publications with NDUFA9 and Adenocarcinoma
 Abnormalities, Drug-Induced Antibodies  >1 publications with NDUFA9 and Abnormalities, Drug-Induced
 Liver Neoplasms Antibodies  >1 publications with NDUFA9 and Liver Neoplasms

Organs/Tissues associated with anti-NDUFA9 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >4 publications with NDUFA9 and Blood
 Muscle Antibodies  >4 publications with NDUFA9 and Muscle
 Liver Antibodies  >3 publications with NDUFA9 and Liver
 Heart Antibodies  >3 publications with NDUFA9 and Heart
 Embryonic Tissue Antibodies  >2 publications with NDUFA9 and Embryonic Tissue
 Pancreas Antibodies  >1 publications with NDUFA9 and Pancreas
 Prostate Antibodies  >1 publications with NDUFA9 and Prostate
 Kidney Antibodies  >1 publications with NDUFA9 and Kidney
 Testis Antibodies  >1 publications with NDUFA9 and Testis
 Ganglia Antibodies  >1 publications with NDUFA9 and Ganglia
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000