Mouse Anti-TCIRG1 Monoclonal Antibody – Cat# MBS6134150

Western Blot detection against Immunogen (36.74kD).

TCIRG1 Antibody – Mouse Monoclonal

Name: TCIRG1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6134150
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6134150

MBS6134150 is an antibody targeting TCIRG1. Also known as TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune… More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TCIRG1, Monoclonal Antibody

Full Product Name

TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune Response cDNA7 Protein, TIRC7, Vacuolar Proton Transloc

Product Gene Name

anti-TCIRG1 antibody

Product Synonym Names

a3; Atp6i; OPTB1; Stv1; Vph1

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

6H3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TCIRG1.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

68,776 Da

Immunogen

Partial recombinant corresponding to aa121-220 from TCIRG1 (AAH18133) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL

Conjugate

Product Categories/Family for anti-TCIRG1 antibody

Antibodies; Enzymes; ATPase

Applications Tested/Suitable for anti-TCIRG1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-TCIRG1 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-TCIRG1 antibody

1. A specific subtype of osteoclasts secretes factors inducing nodule formation by osteoblasts. Henriksen K, Andreassen KV, Thudium CS, Gudmann KN, Moscatelli I, Cruger-Hansen CE, Schulz AS, Dziegiel MH, Richter J, Karsdal MA, Neutzsky-Wulff AV.Bone. 2012 Jun 19;51(3):353-361. 2. Impaired gastric acidification negatively affects calcium homeostasis and bone mass. Schinke T, Schilling AF, Baranowsky A, Seitz S, Marshall RP, Linn T, Blaeker M, Huebner AK, Schulz A, Simon R, Gebauer M, Priemel M, Kornak U, Perkovic S, Barvencik F, Beil FT, Del Fattore A, Frattini A, Streichert T, Pueschel K, Villa A, Debatin KM, RuegNat Med. 2009 Jun;15(6):674-81. 3. Differential Localization of Vacuolar H+-ATPases Containing a1, a2, a3, or a4 (ATP6V0A1-4) Subunit Isoforms Along the Nephron. Schulz N, Dave MH, Stehberger PA, Chau T, Wagner CA.Cell Physiol Biochem. 2007;20(1-4):109-20.

Other Notes

Small volumes of anti-TCIRG1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TCIRG1. It may not necessarily be applicable to this product.

NCBI GI #

17390297

NCBI GeneID

10312

NCBI Accession #

BC018133

NCBI Related Accession #

AAH18133

UniProt Secondary Accession #

O75877; Q8WVC5

UniProt Related Accession #

Q13488

NCBI Official Full Name

Homo sapiens T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, mRNA

NCBI Official Synonym Full Names

T-cell immune regulator 1, ATPase H+ transporting V0 subunit a3

NCBI Official Symbol

TCIRG1

NCBI Official Synonym Symbols

a3; Stv1; Vph1; Atp6i; OC116; OPTB1; TIRC7; ATP6N1C; ATP6V0A3; OC-116kDa

Protein Family

V-type proton ATPase

NCBI Protein Information

V-type proton ATPase 116 kDa subunit a isoform 3

NCBI Summary for TCIRG1

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq, Jul 2008]

Research Articles on TCIRG1

1. The highly invasive human breast cancer cell lines express higher levels of the a3 isoform than poorly invasive lines; knockdown of a3 reduces both expression of V-ATPases at the plasma membrane and in vitro invasion of breast tumor cells. (Review)

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-TCIRG1 antibody

Products by Pathway	Pathway Diagram
Collecting Duct Acid Secretion Pathway antibodies	Collecting Duct Acid Secretion Pathway Diagram
Collecting Duct Acid Secretion Pathway antibodies	Collecting Duct Acid Secretion Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway antibodies	Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway Diagram
Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway antibodies	Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway Diagram
Insulin Receptor Recycling Pathway antibodies	Insulin Receptor Recycling Pathway Diagram
Iron Uptake And Transport Pathway antibodies	Iron Uptake And Transport Pathway Diagram
Latent Infection Of Homo Sapiens With Mycobacterium Tuberculosis Pathway antibodies	Latent Infection Of Homo Sapiens With Mycobacterium Tuberculosis Pathway Diagram
Lysosome Pathway antibodies	Lysosome Pathway Diagram
Lysosome Pathway antibodies	Lysosome Pathway Diagram

Diseases associated with anti-TCIRG1 antibody

Disease Name	Pubmed Publications
Osteopetrosis, Autosomal Recessive 1 Antibodies	>16 publications with TCIRG1 and Osteopetrosis, Autosomal Recessive 1
Death Antibodies	>6 publications with TCIRG1 and Death
Necrosis Antibodies	>5 publications with TCIRG1 and Necrosis
Atrophy Antibodies	>4 publications with TCIRG1 and Atrophy
Congenital Abnormalities Antibodies	>4 publications with TCIRG1 and Congenital Abnormalities
Immune System Diseases Antibodies	>4 publications with TCIRG1 and Immune System Diseases
Brain Diseases Antibodies	>3 publications with TCIRG1 and Brain Diseases
Neoplasms Antibodies	>2 publications with TCIRG1 and Neoplasms
Inflammation Antibodies	>2 publications with TCIRG1 and Inflammation
Kidney Diseases Antibodies	>2 publications with TCIRG1 and Kidney Diseases

Organs/Tissues associated with anti-TCIRG1 antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>58 publications with TCIRG1 and Bone
Blood Antibodies	>21 publications with TCIRG1 and Blood
Bone Marrow Antibodies	>17 publications with TCIRG1 and Bone Marrow
Brain Antibodies	>7 publications with TCIRG1 and Brain
Nerve Antibodies	>6 publications with TCIRG1 and Nerve
Connective Tissue Antibodies	>5 publications with TCIRG1 and Connective Tissue
Liver Antibodies	>4 publications with TCIRG1 and Liver
Kidney Antibodies	>4 publications with TCIRG1 and Kidney
Spleen Antibodies	>4 publications with TCIRG1 and Spleen
Eye Antibodies	>2 publications with TCIRG1 and Eye