• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GLYAT Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6136793

MBS6136793 is an antibody targeting GLYAT. Also known as GLYAT (ACGNAT, CAT, GAT, Glycine N-acyltransferase, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, Benzoyl-coenzyme A:glycine… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GLYAT, Monoclonal Antibody
Full Product Name
GLYAT (ACGNAT, CAT, GAT, Glycine N-acyltransferase, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, Benzoyl-coenzyme A:glycine N-acyltransferase, Glycine N-benzoyltransferase, HRP-1(CL
Product Gene Name
anti-GLYAT antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GLYAT.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
607424
3D Structure
ModBase 3D Structure for Q6IB77
Immunogen
Partial recombinant corresponding to aa64-163 from GLYAT (NP_964011) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAI
Conjugate
APC

Product Categories/Family for anti-GLYAT antibody

Antibodies; Enzymes; Acyltransferase
Applications Tested/Suitable for anti-GLYAT antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-GLYAT antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GLYAT antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-GLYAT Monoclonal Antibody – Cat# MBS6136793

Immunohistochemistry (IHC) of anti-GLYAT antibody

Immunoperoxidase of monoclonal antibody to GLYAT on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml]
Mouse Anti-GLYAT Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6136793

Testing Data of anti-GLYAT antibody

Detection limit for recombinant GST tagged GLYAT is 0.1ng/ml as a capture antibody.
Mouse Anti-GLYAT Monoclonal Antibody, Testing Data – Cat# MBS6136793

Other Notes

Small volumes of anti-GLYAT antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for GLYAT. It may not necessarily be applicable to this product.

NCBI GI #
1519315630
NCBI GeneID
10249
NCBI Accession #
NM_201648.3
UniProt Primary Accession #
Q6IB77
UniProt Related Accession #
Q6IB77
GenBank Nucleotide #
NM_201648
NCBI Official Full Name
Homo sapiens glycine-N-acyltransferase (GLYAT), transcript variant 1, mRNA
NCBI Official Synonym Full Names
glycine-N-acyltransferase
NCBI Official Symbol
GLYAT
NCBI Official Synonym Symbols
CAT; GAT; ACGNAT
UniProt Protein Name
Glycine N-acyltransferase
UniProt Synonym Protein Names
Acyl-CoA:glycine N-acyltransferase; AAc; Aralkyl acyl-CoA N-acyltransferase; Aralkyl acyl-CoA:amino acid N-acyltransferase; Benzoyl-coenzyme A:glycine N-acyltransferase; Glycine N-benzoyltransferase; HRP-1(CLP)
Protein Family
Glycine N-acyltransferase
UniProt Gene Name
GLYAT
UniProt Synonym Gene Names
ACGNAT; CAT; GAT; AAc
UniProt Entry Name
GLYAT_HUMAN
NCBI Protein Information
glycine N-acyltransferase

NCBI Summary for GLYAT

The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for GLYAT

GLYAT: Mitochondrial acyltransferase which transfers an acyl group to the N-terminus of glycine and glutamine, although much less efficiently. Can conjugate numerous substrates to form a variety of N-acylglycines, with a preference for benzoyl-CoA over phenylacetyl-CoA as acyl donors. Thereby detoxify xenobiotics, such as benzoic acid or salicylic acid, and endogenous organic acids, such as isovaleric acid. Belongs to the glycine N-acyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.3.1.13; Mitochondrial; EC 2.3.1.71; Transferase

Chromosomal Location of Human Ortholog: 11q12.1

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: glycine N-benzoyltransferase activity; glycine N-acyltransferase activity; transferase activity, transferring acyl groups

Biological Process: glycine metabolic process; acyl-CoA metabolic process; response to toxin; xenobiotic metabolic process; monocarboxylic acid metabolic process
Show more

Research Articles on GLYAT

1. GLYAT exhibits mechanistic kinetic cooperativity towards its substrate glycine.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000