• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HABP2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6136915

HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HABP2, Monoclonal Antibody
Full Product Name
HABP2 (Hyaluronan-binding Protein 2, Factor VII-activating Protease, Factor Seven-activating Protease, FSAP, HGFAL, PHBP, Hepatocyte Growth Factor Activator-like Protein, Plasma Hyaluronan-binding Protein) APC
Product Gene Name
anti-HABP2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes human HABP2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
603924
3D Structure
ModBase 3D Structure for Q14520
Immunogen
Partial recombinant protein corresponding to aa105-204 from human HABP2 (NP_004123) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
Conjugate
APC

Product Categories/Family for anti-HABP2 antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-HABP2 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes for anti-HABP2 antibody
Applications are based on unconjugated antibody.

Immunoprecipitation (IP) of anti-HABP2 antibody

Immunoprecipitation of HABP2 transfected lysate using 127702 and Protein A Magnetic Bead, and immunoblotted with HABP2 rabbit polyclonal antibody.
Mouse Anti-HABP2 Monoclonal Antibody – Cat# MBS6136915

Testing Data of anti-HABP2 antibody

Detection limit for recombinant GST tagged HABP2 is ~1ng/ml as a capture antibody.
Mouse Anti-HABP2 Monoclonal Antibody, Testing Data – Cat# MBS6136915

Product References and Citations for anti-HABP2 antibody

1. Variation in Hyaluronan-Binding Protein 2 (HABP2) Promoter Region is Associated With Unexplained Female Infertility. Altmae S, Kallak TK, Friden B, Stavreus-Evers A.Reprod Sci. 2010 Nov 22.

Other Notes

Small volumes of anti-HABP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HABP2 purchase

MBS6136915 is an antibody targeting HABP2. Also known as HABP2 (Hyaluronan-binding Protein 2, Factor VII-activating Protease, Factor Seven-activating Protease, FSAP, HGFAL, PHBP, Hepatocyte Growth Factor Activator-like Protein, Plasma Hyaluronan-binding Protein) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HABP2. It may not necessarily be applicable to this product.

NCBI GI #
1519245595
NCBI GeneID
3026
NCBI Accession #
NM_004132.5
UniProt Primary Accession #
Q14520
UniProt Related Accession #
Q14520
GenBank Nucleotide #
NM_004132
NCBI Official Full Name
Homo sapiens hyaluronan binding protein 2 (HABP2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
hyaluronan binding protein 2
NCBI Official Symbol
HABP2
NCBI Official Synonym Symbols
FSAP; HABP; PHBP; HGFAL; NMTC5
UniProt Protein Name
Hyaluronan-binding protein 2
UniProt Synonym Protein Names
Factor VII-activating protease; Factor seven-activating protease; FSAP; Hepatocyte growth factor activator-like protein; Plasma hyaluronan-binding proteinCleaved into the following 4 chains:Hyaluronan-binding protein 2 50 kDa heavy chain; Hyaluronan-binding protein 2 50 kDa heavy chain alternate form; Hyaluronan-binding protein 2 27 kDa light chain; Hyaluronan-binding protein 2 27 kDa light chain alternate form
Protein Family
Hyaluronan-binding protein
UniProt Gene Name
HABP2
UniProt Synonym Gene Names
HGFAL; PHBP; FSAP
UniProt Entry Name
HABP2_HUMAN
NCBI Protein Information
hyaluronan-binding protein 2

NCBI Summary for HABP2

This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by hepatocytes and proteolytically processed to generate heavy and light chains that form the mature heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This extracellular protease binds hyaluronic acid and may play a role in the coagulation and fibrinolysis systems. Mutations in this gene are associated with nonmedullary thyroid cancer and susceptibility to venous thromboembolism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]
Show more

Research Articles on HABP2

1. HABP2 Marburg-I variant is a strong regulator of FSAP activity. A novel locus near ADCY2 was identified as a potential additional regulator of FSAP activity.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000