• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

KLRC4 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137330

May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
KLRC4, Monoclonal Antibody
Full Product Name
KLRC4 (NKG2F, NKG2-F Type II Integral Membrane Protein, NK Cell Receptor F, NKG2-F-activating NK Receptor, FLJ17759, FLJ78582) APC
Product Gene Name
anti-KLRC4 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human KLRC4.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
18,234 Da
Immunogen
Full-length recombinant corresponding to aa1-159 from KLRC4 (AAH17784) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL*
Conjugate
APC

Product Categories/Family for anti-KLRC4 antibody

Antibodies; Receptors
Applications Tested/Suitable for anti-KLRC4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-KLRC4 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-KLRC4 antibody

Western Blot analysis of KLRC4 expression in transfected 293T cell line by KLRC4 monoclonal antibody. Lane 1: KLRC4 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.
Mouse Anti-KLRC4 Monoclonal Antibody – Cat# MBS6137330

Testing Data of anti-KLRC4 antibody

Detection limit for recombinant GST tagged KLRC4 is 0.3ng/ml as a capture antibody.
Mouse Anti-KLRC4 Monoclonal Antibody, Testing Data – Cat# MBS6137330

Other Notes

Small volumes of anti-KLRC4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KLRC4 purchase

MBS6137330 is an antibody targeting KLRC4. Also known as KLRC4 (NKG2F, NKG2-F Type II Integral Membrane Protein, NK Cell Receptor F, NKG2-F-activating NK Receptor, FLJ17759, FLJ78582) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for KLRC4. It may not necessarily be applicable to this product.

NCBI GI #
17389488
NCBI GeneID
8302
NCBI Accession #
BC017784
NCBI Related Accession #
AAH17784
UniProt Secondary Accession #
O60851
UniProt Related Accession #
O43908
NCBI Official Full Name
Homo sapiens killer cell lectin-like receptor subfamily C, member 4, mRNA
NCBI Official Synonym Full Names
killer cell lectin like receptor C4
NCBI Official Symbol
KLRC4
NCBI Official Synonym Symbols
NKG2F; NKG2-F
Protein Family
NKG2-F type II integral membrane protein
NCBI Protein Information
NKG2-F type II integral membrane protein

NCBI Summary for KLRC4

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene is a member of the NKG2 group of genes that are expressed primarily in natural killer (NK) cells. These family members encode transmembrane proteins that are characterized by a type II membrane orientation (have an extracellular C-terminus) and the presence of a C-type lectin domain. This family member is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. Read-through transcription exists between this gene and the downstream KLRK1 (killer cell lectin-like receptor subfamily K, member 1) family member. [provided by RefSeq, Dec 2010]
Show more

Research Articles on KLRC4

1. CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-KLRC4 antibody

 Products by Pathway  Pathway Diagram
 Antigen Processing And Presentation Pathway antibodies  Antigen Processing And Presentation Pathway Diagram
 Antigen Processing And Presentation Pathway antibodies  Antigen Processing And Presentation Pathway Diagram

Diseases associated with anti-KLRC4 antibody

 Disease Name  Pubmed Publications
 Thrombosis Antibodies  >1 publications with KLRC4 and Thrombosis
 Eye Diseases Antibodies  >1 publications with KLRC4 and Eye Diseases
 Leukemia, Lymphocytic, Chronic, B-Cell Antibodies  >1 publications with KLRC4 and Leukemia, Lymphocytic, Chronic, B-Cell
 Behcet Syndrome Antibodies  >1 publications with KLRC4 and Behcet Syndrome
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000