Mouse Anti-LASS1 Monoclonal Antibody – Cat# MBS6137366

Western Blot detection against Immunogen (31.61kD).

LASS1 Antibody – Mouse Monoclonal

Name: LASS1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6137366
Price: 1155 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137366

Involved in the biogenesis of the 60S ribosomal subunit. Required for maturation of the 28S rRNA. Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to… More details

$1155 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LASS1, Monoclonal Antibody

Full Product Name

LASS1 (CerS1, LAG1, MGC90349, UOG1, LAG1 Longevity Assurance Homolog 1, Longevity Assurance Gene 1 Protein Homolog 1, Protein UOG-1) APC

Product Gene Name

anti-LASS1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2E8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human LASS1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

39536

Chromosome Location

Chromosome: 19; NC_000019.9 (18979361..19006953, complement). Location: 19p12

OMIM

606919

3D Structure

ModBase 3D Structure for P27544

Immunogen

Partial recombinant corresponding to aa301-350 from human LASS1 (NP_067090) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF

Conjugate

APC

Product Categories/Family for anti-LASS1 antibody

Antibodies; Enzymes; Synthase

Applications Tested/Suitable for anti-LASS1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-LASS1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-LASS1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LASS1 purchase

MBS6137366 is an antibody targeting LASS1. Also known as LASS1 (CerS1, LAG1, MGC90349, UOG1, LAG1 Longevity Assurance Homolog 1, Longevity Assurance Gene 1 Protein Homolog 1, Protein UOG-1) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for LASS1. It may not necessarily be applicable to this product.

NCBI GI #

11641421

NCBI GeneID

10715

NCBI Accession #

NP_067090.1

UniProt Primary Accession #

P27544

UniProt Related Accession #

P27544

GenBank Nucleotide #

NM_021267

NCBI Official Full Name

ceramide synthase 1 isoform 1

NCBI Official Synonym Full Names

ceramide synthase 1

NCBI Official Symbol

CERS1

NCBI Official Synonym Symbols

LAG1; UOG1; LASS1

UniProt Protein Name

Ceramide synthase 1

UniProt Synonym Protein Names

LAG1 longevity assurance homolog 1; Longevity assurance gene 1 protein homolog 1; Protein UOG-1

UniProt Gene Name

CERS1

UniProt Synonym Gene Names

LAG1; LASS1; UOG1; CerS1

UniProt Entry Name

CERS1_HUMAN

NCBI Protein Information

ceramide synthase 1; protein UOG-1; upstream of GDF1; longevity assurance gene 1 protein homolog 1; longevity assurance (LAG1, S. cerevisiae) homolog 1

NCBI Summary for LASS1

This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq, Jul 2008]

UniProt Comments for LASS1

Function: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Isoform 1: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Golgi apparatus membrane; Multi-pass membrane protein

By similarity. Note: Isoform 1 may recycle from the Golgi to the endoplasmic reticulum.

Miscellaneous: This protein is produced by a bicistronic gene which also produces the GDF1 protein from a non-overlapping reading frame.

Sequence similarities: Contains 1 TLC (TRAM/LAG1/CLN8) domain.

Research Articles on LASS1

1. This study highlights a close interaction between CLN5/CLN8 proteins, and their role in sphingolipid metabolism. Our findings suggest that CLN5p/CLN8p most likely are positive modulators of CerS1 and/or CerS2.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-LASS1 antibody

Reference Product	PubMed Publications
CLN8 antibody	>3 publications with LASS1 and CLN8
SPTLC3 antibody	>2 publications with LASS1 and SPTLC3
SPTLC1 antibody	>1 publications with LASS1 and SPTLC1
GDF1 antibody	>1 publications with LASS1 and GDF1

Pathways associated with anti-LASS1 antibody

Products by Pathway	Pathway Diagram
Ceramide Biosynthesis Pathway antibodies	Ceramide Biosynthesis Pathway Diagram
Ceramide Biosynthesis Pathway antibodies	Ceramide Biosynthesis Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Lipids And Lipoproteins Pathway antibodies	Metabolism Of Lipids And Lipoproteins Pathway Diagram
Sphingolipid De Novo Biosynthesis Pathway antibodies	Sphingolipid De Novo Biosynthesis Pathway Diagram
Sphingolipid Metabolism Pathway antibodies	Sphingolipid Metabolism Pathway Diagram
Sphingolipid Metabolism Pathway antibodies	Sphingolipid Metabolism Pathway Diagram
Sphingolipid Metabolism Pathway antibodies	Sphingolipid Metabolism Pathway Diagram
Sphingosine Biosynthesis Pathway antibodies	Sphingosine Biosynthesis Pathway Diagram
Sphingosine Biosynthesis Pathway antibodies	Sphingosine Biosynthesis Pathway Diagram

Diseases associated with anti-LASS1 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>13 publications with LASS1 and Neoplasms
Metabolic Diseases Antibodies	>2 publications with LASS1 and Metabolic Diseases
Inflammation Antibodies	>1 publications with LASS1 and Inflammation

Organs/Tissues associated with anti-LASS1 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>6 publications with LASS1 and Brain
Nerve Antibodies	>2 publications with LASS1 and Nerve
Lung Antibodies	>2 publications with LASS1 and Lung
Skin Antibodies	>2 publications with LASS1 and Skin
Muscle Antibodies	>1 publications with LASS1 and Muscle
Embryonic Tissue Antibodies	>1 publications with LASS1 and Embryonic Tissue