Mouse Anti-LEFTYA Monoclonal Antibody – Cat# MBS6137387

LEFTY2 monoclonal antibody, clone 1H6. Western Blot analysis of LEFTY2 expression in human Skeletal muscle.

LEFTYA Antibody – Mouse Monoclonal

Name: LEFTYA Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6137387
Price: 1155 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137387

During vertebrate embryogenesis, a left-right axis is established. Secreted growth factors of the TGF-beta family, including gene products derived from nodal, lefty-1 and lefty-2, play crucial roles in establishing left-right asymmetries. TGF-beta… More details

$1155 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LEFTYA, Monoclonal Antibody

Full Product Name

LEFTYA (Left-right Determination Factor 2, Protein Lefty-2, Left-right Determination Factor A, Protein Lefty-A, Transforming Growth Factor beta-4, TGF-beta-4, Endometrial Bleeding-associated Factor, EBAF, LEFTA, LEFTY2, TGFB4, PSEC0024, MGC46222) APC

Product Gene Name

anti-LEFTYA antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

1H6

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human LEFTY2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

40kDa

OMIM

601877

3D Structure

ModBase 3D Structure for O00292

Immunogen

Full length recombinant corresponding to aa77-180 from human LEFTY2 (NP_003231) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV

Conjugate

APC

Product Categories/Family for anti-LEFTYA antibody

Antibodies; Growth Factors; Cytokines

Applications Tested/Suitable for anti-LEFTYA antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-LEFTYA antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-LEFTYA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LEFTYA purchase

MBS6137387 is an antibody targeting LEFTYA. Also known as LEFTYA (Left-right Determination Factor 2, Protein Lefty-2, Left-right Determination Factor A, Protein Lefty-A, Transforming Growth Factor beta-4, TGF-beta-4, Endometrial Bleeding-associated Factor, EBAF, LEFTA, LEFTY2, TGFB4, PSEC0024, MGC46222) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for LEFTYA. It may not necessarily be applicable to this product.

NCBI GI #

27436881

NCBI GeneID

7044

NCBI Accession #

NP_003231

UniProt Primary Accession #

O00292

UniProt Related Accession #

O00292

GenBank Nucleotide #

NM_003240

NCBI Official Full Name

left-right determination factor 2 isoform 1 preproprotein

NCBI Official Synonym Full Names

left-right determination factor 2

NCBI Official Symbol

LEFTY2

NCBI Official Synonym Symbols

EBAF; LEFTA; TGFB4; LEFTYA

UniProt Protein Name

Left-right determination factor 2

UniProt Synonym Protein Names

Endometrial bleeding-associated factor; Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4

UniProt Gene Name

LEFTY2

UniProt Synonym Gene Names

EBAF; LEFTA; LEFTYA; TGFB4; TGF-beta-4

UniProt Entry Name

LFTY2_HUMAN

NCBI Protein Information

left-right determination factor 2

NCBI Summary for LEFTYA

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. This gene is closely linked to both a related family member and a related pseudogene. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]

UniProt Comments for LEFTYA

LEFTY2: Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding. Defects in LEFTY2 are the cause of left-right axis malformations (LRAM). The defect includes left pulmonary isomerism, with cardiac anomalies characterized by complete atrioventricular canal defect and hypoplastic left ventricle, and interrupted inferior vena cava. Belongs to the TGF-beta family.

Protein type: Ligand, receptor tyrosine kinase; Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 1q42.1

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; platelet activation; platelet degranulation; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; multicellular organismal development; cell growth; blood coagulation; cell development

Research Articles on LEFTYA

1. In a reaction-diffusion pattern, the effective range of Nodal is 3.5 times narrower than that of Lefty2.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-LEFTYA antibody

Reference Product	PubMed Publications
NODAL antibody	>49 publications with LEFTYA and NODAL
PITX2 antibody	>29 publications with LEFTYA and PITX2
TDGF1 antibody	>3 publications with LEFTYA and TDGF1
CFC1 antibody	>3 publications with LEFTYA and CFC1
TGFB1 antibody	>3 publications with LEFTYA and TGFB1
INVS antibody	>1 publications with LEFTYA and INVS
TGFB3 antibody	>1 publications with LEFTYA and TGFB3

Pathways associated with anti-LEFTYA antibody

Products by Pathway	Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
Hemostasis Pathway antibodies	Hemostasis Pathway Diagram
Platelet Activation, Signaling And Aggregation Pathway antibodies	Platelet Activation, Signaling And Aggregation Pathway Diagram
Platelet Degranulation Pathway antibodies	Platelet Degranulation Pathway Diagram
Regulation Of Signaling By NODAL Pathway antibodies	Regulation Of Signaling By NODAL Pathway Diagram
Response To Elevated Platelet Cytosolic Ca2+ Pathway antibodies	Response To Elevated Platelet Cytosolic Ca2+ Pathway Diagram
Signaling By NODAL Pathway antibodies	Signaling By NODAL Pathway Diagram
Signaling Pathways Regulating Pluripotency Of Stem Cells antibodies	Signaling Pathways Regulating Pluripotency Of Stem Cells Diagram
Signaling Pathways Regulating Pluripotency Of Stem Cells antibodies	Signaling Pathways Regulating Pluripotency Of Stem Cells Diagram
TGF Beta Signaling Pathway antibodies	TGF Beta Signaling Pathway Diagram

Diseases associated with anti-LEFTYA antibody

Disease Name	Pubmed Publications
Congenital Abnormalities Antibodies	>11 publications with LEFTYA and Congenital Abnormalities
Heart Diseases Antibodies	>8 publications with LEFTYA and Heart Diseases
Cardiovascular Diseases Antibodies	>7 publications with LEFTYA and Cardiovascular Diseases
Infertility, Female Antibodies	>4 publications with LEFTYA and Infertility, Female
Abnormalities, Multiple Antibodies	>3 publications with LEFTYA and Abnormalities, Multiple
Adenocarcinoma Antibodies	>2 publications with LEFTYA and Adenocarcinoma
Abnormalities, Drug-Induced Antibodies	>1 publications with LEFTYA and Abnormalities, Drug-Induced
Disease Models, Animal Antibodies	>1 publications with LEFTYA and Disease Models, Animal
Edema Antibodies	>1 publications with LEFTYA and Edema
Breast Neoplasms Antibodies	>1 publications with LEFTYA and Breast Neoplasms

Organs/Tissues associated with anti-LEFTYA antibody

Organ/Tissue Name	Pubmed Publications
Heart Antibodies	>25 publications with LEFTYA and Heart
Embryonic Tissue Antibodies	>16 publications with LEFTYA and Embryonic Tissue
Uterus Antibodies	>13 publications with LEFTYA and Uterus
Brain Antibodies	>7 publications with LEFTYA and Brain
Placenta Antibodies	>7 publications with LEFTYA and Placenta
Eye Antibodies	>5 publications with LEFTYA and Eye
Kidney Antibodies	>4 publications with LEFTYA and Kidney
Connective Tissue Antibodies	>2 publications with LEFTYA and Connective Tissue
Ovary Antibodies	>2 publications with LEFTYA and Ovary
Intestine Antibodies	>2 publications with LEFTYA and Intestine