• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

LZTFL1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137472

MBS6137472 is an antibody targeting LZTFL1. Also known as LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) APC. Reactive in Human. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
LZTFL1, Monoclonal Antibody
Full Product Name
LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) APC
Product Gene Name
anti-LZTFL1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7F6
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human LZTFL1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
37.0kDa (322aa) confirmed by MALDI-TOF
OMIM
606568
3D Structure
ModBase 3D Structure for Q9NQ48
Immunogen
Partial recombinant corresponding to aa200-300 from human LZTFL1 (NP_065080) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Conjugate
APC

Product Categories/Family for anti-LZTFL1 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-LZTFL1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-LZTFL1 antibody
IF: 25ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-LZTFL1 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-LZTFL1 Monoclonal Antibody – Cat# MBS6137472

Western Blot (WB) of anti-LZTFL1 antibody

Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody. Lane 1: LZTFL1 transfected lysate (34.6kD). Lane 2: Non-transfected lysate.
Mouse Anti-LZTFL1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137472

Immunohistochemistry (IHC) of anti-LZTFL1 antibody

Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].
Mouse Anti-LZTFL1 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6137472

Immunofluorescence (IF) of anti-LZTFL1 antibody

Immunofluorescence of monoDetection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.clonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25ug/ml].
Mouse Anti-LZTFL1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6137472

Testing Data of anti-LZTFL1 antibody

Detection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.
Mouse Anti-LZTFL1 Monoclonal Antibody, Testing Data – Cat# MBS6137472

Western Blot (WB) of anti-LZTFL1 antibody

LZTFL1 monoclonal antibody, Western Blot analysis of LZTFL1 expression in HeLa.
Mouse Anti-LZTFL1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137472

Product References and Citations for anti-LZTFL1 antibody

1. A Novel Protein LZTFL1 Regulates Ciliary Trafficking of the BBSome and Smoothened. Seo S, Zhang Q, Bugge K, Breslow DK, Searby CC, Nachury MV, Sheffield VC.PLoS Genet. 2011 Nov;7(11):e1002358. Epub 2011 Nov 3.

Other Notes

Small volumes of anti-LZTFL1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for LZTFL1. It may not necessarily be applicable to this product.

NCBI GI #
9966793
NCBI GeneID
54585
NCBI Accession #
NP_065080
UniProt Primary Accession #
Q9NQ48
UniProt Secondary Accession #
Q8TC61; Q9NQ56; B3KSI9; B4E0K7
UniProt Related Accession #
Q9NQ48
GenBank Nucleotide #
NM_020347
NCBI Official Full Name
leucine zipper transcription factor-like protein 1 isoform 1
NCBI Official Synonym Full Names
leucine zipper transcription factor like 1
NCBI Official Symbol
LZTFL1
NCBI Official Synonym Symbols
BBS17
UniProt Protein Name
Leucine zipper transcription factor-like protein 1
Protein Family
Leucine zipper transcription factor-like protein
UniProt Gene Name
LZTFL1
UniProt Entry Name
LZTL1_HUMAN
NCBI Protein Information
leucine zipper transcription factor-like protein 1

NCBI Summary for LZTFL1

This gene encodes a ubiquitously expressed protein that localizes to the cytoplasm. This protein interacts with Bardet-Biedl Syndrome (BBS) proteins and, through its interaction with BBS protein complexes, regulates protein trafficking to the ciliary membrane. Nonsense mutations in this gene cause a form of Bardet-Biedl Syndrome; a ciliopathy characterized in part by polydactyly, obesity, cognitive impairment, hypogonadism, and kidney failure. This gene may also function as a tumor suppressor; possibly by interacting with E-cadherin and the actin cytoskeleton and thereby regulating the transition of epithelial cells to mesenchymal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2013]
Show more

UniProt Comments for LZTFL1

LZTFL1: Belongs to the LZTFL1 family.

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: cytosol

Molecular Function: identical protein binding; protein binding; protein complex binding

Disease: Bardet-biedl Syndrome 17

Research Articles on LZTFL1

1. LZTFL1 inhibits lung tumorigenesis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-LZTFL1 antibody

 Reference Product  PubMed Publications
 BBS2 antibody  >1 publications with LZTFL1 and BBS2
 BBS7 antibody  >1 publications with LZTFL1 and BBS7
 BBS9 antibody  >1 publications with LZTFL1 and BBS9

Pathways associated with anti-LZTFL1 antibody

 Products by Pathway  Pathway Diagram
 BBSome-mediated Cargo-targeting To Cilium Pathway antibodies  BBSome-mediated Cargo-targeting To Cilium Pathway Diagram
 Cargo Trafficking To The Periciliary Membrane Pathway antibodies  Cargo Trafficking To The Periciliary Membrane Pathway Diagram
 Cilium Assembly Pathway antibodies  Cilium Assembly Pathway Diagram
 Organelle Biogenesis And Maintenance Pathway antibodies  Organelle Biogenesis And Maintenance Pathway Diagram

Diseases associated with anti-LZTFL1 antibody

 Disease Name  Pubmed Publications
 Brain Diseases Antibodies  >3 publications with LZTFL1 and Brain Diseases
 Nervous System Diseases Antibodies  >3 publications with LZTFL1 and Nervous System Diseases
 Hypertension Antibodies  >1 publications with LZTFL1 and Hypertension
 Abnormalities, Drug-Induced Antibodies  >1 publications with LZTFL1 and Abnormalities, Drug-Induced
 Cognition Disorders Antibodies  >1 publications with LZTFL1 and Cognition Disorders

Organs/Tissues associated with anti-LZTFL1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >3 publications with LZTFL1 and Brain
 Blood Antibodies  >1 publications with LZTFL1 and Blood
 Stomach Antibodies  >1 publications with LZTFL1 and Stomach
 Intestine Antibodies  >1 publications with LZTFL1 and Intestine
 Kidney Antibodies  >1 publications with LZTFL1 and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000