• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TADA2B Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137609

MBS6137609 is an antibody targeting TADA2B. Also known as TADA2B (Transcriptional Adapter 2-beta, ADA2-like Protein beta, ADA2-beta, ADA2B, MGC21874) APC. Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TADA2B, Monoclonal Antibody
Full Product Name
TADA2B (Transcriptional Adapter 2-beta, ADA2-like Protein beta, ADA2-beta, ADA2B, MGC21874) APC
Product Gene Name
anti-TADA2B antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MGC21874. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa2-111 from MGC21874 (XP_291105) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Conjugate
APC

Product Categories/Family for anti-TADA2B antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-TADA2B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-TADA2B antibody
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TADA2B antibody

Western Blot detection against Immunogen (38.1kD).
Mouse Anti-TADA2B Monoclonal Antibody – Cat# MBS6137609

Western Blot (WB) of anti-TADA2B antibody

MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in Raw 264.7.
Mouse Anti-TADA2B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137609

Western Blot (WB) of anti-TADA2B antibody

MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in NIH/3T3.
Mouse Anti-TADA2B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137609

Immunohistochemistry (IHC) of anti-TADA2B antibody

Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].
Mouse Anti-TADA2B Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6137609

Testing Data of anti-TADA2B antibody

Detection limit for recombinant GST tagged MGC21874 is ~0.3ng/ml as a capture antibody.
Mouse Anti-TADA2B Monoclonal Antibody, Testing Data – Cat# MBS6137609

Western Blot (WB) of anti-TADA2B antibody

MGC21874 monoclonal antibody, Western Blot analysis of MGC21874 expression in HeLa.
Mouse Anti-TADA2B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137609

Western Blot (WB) of anti-TADA2B antibody

MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in PC-12.
Mouse Anti-TADA2B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137609

Other Notes

Small volumes of anti-TADA2B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TADA2B. It may not necessarily be applicable to this product.

NCBI GI #
29729561
NCBI GeneID
93624
NCBI Accession #
XM_291105
NCBI Related Accession #
XP_291105
UniProt Related Accession #
Q86TJ2
NCBI Official Synonym Full Names
transcriptional adaptor 2B
NCBI Official Symbol
TADA2B
NCBI Official Synonym Symbols
ADA2B; ADA2(beta)
Protein Family
Transcriptional adapter
NCBI Protein Information
transcriptional adapter 2-beta

NCBI Summary for TADA2B

TADA2B functions as a transcriptional adaptor protein that potentiates transcription through coordination of histone acetyltransferase (HAT) activity and by linking activation factors to basal transcriptional machinery (Barlev et al., 2003 [PubMed 12972612]).[supplied by OMIM, Apr 2010]

Research Articles on TADA2B

1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000