• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NDN Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137811

MBS6137811 is an antibody targeting NDN. Also known as NDN (Necdin) APC. Reactive in Human. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NDN, Monoclonal Antibody
Full Product Name
NDN (Necdin) APC
Product Gene Name
anti-NDN antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NDN.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
36kDa
OMIM
phenotype 602117
3D Structure
ModBase 3D Structure for Q99608
Immunogen
Partial recombinant corresponding to aa222-322 from human NDN (NP_002478) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Conjugate
APC

Product Categories/Family for anti-NDN antibody

Antibodies; Neuroscience
Applications Tested/Suitable for anti-NDN antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-NDN antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NDN antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-NDN Monoclonal Antibody – Cat# MBS6137811

Western Blot (WB) of anti-NDN antibody

NDN monoclonal antibody Western Blot analysis of NDN expression in HL-60.
Mouse Anti-NDN Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137811

Western Blot (WB) of anti-NDN antibody

Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody. Lane 1: NDN transfected lysate (36.1kD). Lane 2: Non-transfected lysate.
Mouse Anti-NDN Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137811

Immunohistochemistry (IHC) of anti-NDN antibody

Immunoperoxidase of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5ug/ml]
Mouse Anti-NDN Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6137811

Immunofluorescence (IF) of anti-NDN antibody

Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-NDN Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6137811

Testing Data of anti-NDN antibody

Detection limit for recombinant GST tagged NDN is ~0.03ng/ml as a capture antibody.
Mouse Anti-NDN Monoclonal Antibody, Testing Data – Cat# MBS6137811

Western Blot (WB) of anti-NDN antibody

Western blot analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-NDN Monoclonal Antibody, Western Blot (WB) – Cat# MBS6137811

Other Notes

Small volumes of anti-NDN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for NDN. It may not necessarily be applicable to this product.

NCBI GI #
4505349
NCBI GeneID
4692
NCBI Accession #
NP_002478
UniProt Primary Accession #
Q99608
UniProt Related Accession #
Q99608
GenBank Nucleotide #
NM_002487
NCBI Official Full Name
necdin
NCBI Official Synonym Full Names
necdin, MAGE family member
NCBI Official Symbol
NDN
NCBI Official Synonym Symbols
PWCR; HsT16328
UniProt Protein Name
Necdin
Protein Family
Necdin
UniProt Gene Name
NDN
UniProt Entry Name
NECD_HUMAN
NCBI Protein Information
necdin

NCBI Summary for NDN

This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]

UniProt Comments for NDN

NDN: Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle- promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 15q11.2-q12

Cellular Component: centrosome; cell projection; perikaryon; cytosol; nucleus

Molecular Function: gamma-tubulin binding; DNA binding

Biological Process: nervous system development; central nervous system development; transcription, DNA-dependent; nerve growth factor receptor signaling pathway; axon extension; neuron migration; axonal fasciculation; multicellular organismal homeostasis; glial cell migration; sensory perception of pain; post-embryonic development; respiratory system process; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; regulation of growth

Disease: Prader-willi Syndrome
Show more

Research Articles on NDN

1. the single-nucleotide polymorphism rs850807, which is putatively functional and linked with MAGEL2 and NDN Genetic variation in rs850807 was strongly and exclusively associated with the ideas of reference subscale of the schizophrenia spectrum, which is best typified as paranoia

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NDN antibody

 Reference Product  PubMed Publications
 E2F1 antibody  >3 publications with NDN and E2F1
 HIF1A antibody  >2 publications with NDN and HIF1A

Pathways associated with anti-NDN antibody

 Products by Pathway  Pathway Diagram
 Adipogenesis Pathway antibodies  Adipogenesis Pathway Diagram
 P75(NTR)-mediated Signaling Pathway antibodies  P75(NTR)-mediated Signaling Pathway Diagram

Diseases associated with anti-NDN antibody

 Disease Name  Pubmed Publications
 Prader-Willi Syndrome Antibodies  >50 publications with NDN and Prader-Willi Syndrome
 Obesity Antibodies  >39 publications with NDN and Obesity
 Neurobehavioral Manifestations Antibodies  >38 publications with NDN and Neurobehavioral Manifestations
 Kidney Diseases Antibodies  >13 publications with NDN and Kidney Diseases
 Carcinoma Antibodies  >12 publications with NDN and Carcinoma
 Cardiovascular Diseases Antibodies  >5 publications with NDN and Cardiovascular Diseases
 Immune System Diseases Antibodies  >5 publications with NDN and Immune System Diseases
 Hypertension Antibodies  >4 publications with NDN and Hypertension
 Breast Neoplasms Antibodies  >4 publications with NDN and Breast Neoplasms
 Inflammation Antibodies  >3 publications with NDN and Inflammation

Organs/Tissues associated with anti-NDN antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >40 publications with NDN and Brain
 Blood Antibodies  >27 publications with NDN and Blood
 Embryonic Tissue Antibodies  >21 publications with NDN and Embryonic Tissue
 Kidney Antibodies  >12 publications with NDN and Kidney
 Muscle Antibodies  >9 publications with NDN and Muscle
 Lung Antibodies  >7 publications with NDN and Lung
 Testis Antibodies  >4 publications with NDN and Testis
 Placenta Antibodies  >4 publications with NDN and Placenta
 Bone Antibodies  >2 publications with NDN and Bone
 Pituitary Gland Antibodies  >2 publications with NDN and Pituitary Gland
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000