• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PARC Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138066

Cytoplasmic anchor protein in p53-associated protein complex. Regulates the subcellular localization of p53 and subsequent function. Seems to be part of an atypical cullin-RING-based E3 ubiquitin-protein ligase complex. In vitro, complexes of CUL9/PARC with… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PARC, Monoclonal Antibody
Full Product Name
PARC (Cullin-9, CUL-9, p53-associated Parkin-like Cytoplasmic Protein, UbcH7-Associated Protein 1, CUL9, H7AP1, KIAA0708, DKFZp686G1042, DKFZp686P2024, RP3-330M21.2) APC
Product Gene Name
anti-PARC antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PARC.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
268,362 Da
OMIM
607489
3D Structure
ModBase 3D Structure for Q8IWT3
Immunogen
Partial recombinant corresponding to aa918-1026 from PARC (NP_055904) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF*
Conjugate
APC

Product Categories/Family for anti-PARC antibody

Antibodies; Cullin
Applications Tested/Suitable for anti-PARC antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PARC antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PARC antibody

Western Blot detection against Immunogen (37.99kD).
Mouse Anti-PARC Monoclonal Antibody – Cat# MBS6138066

Testing Data of anti-PARC antibody

PARC monoclonal antibody Blot analysis of PARC expression in A-431.
Mouse Anti-PARC Monoclonal Antibody, Testing Data – Cat# MBS6138066

Other Notes

Small volumes of anti-PARC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PARC purchase

MBS6138066 is an antibody targeting PARC. Also known as PARC (Cullin-9, CUL-9, p53-associated Parkin-like Cytoplasmic Protein, UbcH7-Associated Protein 1, CUL9, H7AP1, KIAA0708, DKFZp686G1042, DKFZp686P2024, RP3-330M21.2) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PARC. It may not necessarily be applicable to this product.

NCBI GI #
24307991
NCBI GeneID
23113
NCBI Accession #
NP_055904
UniProt Primary Accession #
Q8IWT3
UniProt Secondary Accession #
O75188; Q5TCY3; Q68CP2; Q68D92; Q8N3W9; Q9BU56
UniProt Related Accession #
Q8IWT3
GenBank Nucleotide #
NM_015089
NCBI Official Full Name
cullin-9
NCBI Official Synonym Full Names
cullin 9
NCBI Official Symbol
CUL9
NCBI Official Synonym Symbols
PARC; H7AP1
UniProt Protein Name
Cullin-9
UniProt Synonym Protein Names
UbcH7-associated protein 1; p53-associated parkin-like cytoplasmic protein
Protein Family
DNA topoisomerase
UniProt Gene Name
CUL9
UniProt Synonym Gene Names
H7AP1; KIAA0708; PARC; CUL-9
UniProt Entry Name
CUL9_HUMAN
NCBI Protein Information
cullin-9; CUL-9; UbcH7-associated protein 1; parkin-like cytoplasmic p53 binding protein; p53-associated parkin-like cytoplasmic protein

UniProt Comments for PARC

PARC: Cytoplasmic anchor protein in p53-associated protein complex. Regulates the subcellular localization of p53 and subsequent function. Seems to be part of an atypical cullin-RING- based E3 ubiquitin-protein ligase complex. In vitro, complexes of CUL9/PARC with either CUL7 or TP53 contain E3 ubiquitin-protein ligase activity. Belongs to the cullin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: cullin-RING ubiquitin ligase complex; cytoplasm

Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; ATP binding

Biological Process: ubiquitin-dependent protein catabolic process; regulation of mitosis; protein ubiquitination; microtubule cytoskeleton organization and biogenesis
Show more

Research Articles on PARC

1. the regulation of p53 subcellular localization and apoptosis by PARC as a contributing factor in CDDP resistance in OVCA cells and Ca(2+)/calpain in PARC post-translational processing and chemosensitivity.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PARC antibody

 Reference Product  PubMed Publications
 CUL7 antibody  >2 publications with PARC and CUL7

Diseases associated with anti-PARC antibody

 Disease Name  Pubmed Publications
 Death Antibodies  >2 publications with PARC and Death
 Neoplasm Metastasis Antibodies  >1 publications with PARC and Neoplasm Metastasis

Organs/Tissues associated with anti-PARC antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >1 publications with PARC and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000