• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PHIP Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138219

MBS6138219 is an antibody targeting PHIP. Also known as PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) APC. Reactive in Human. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PHIP, Monoclonal Antibody
Full Product Name
PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) APC
Product Gene Name
anti-PHIP antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PHIP.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
612870
3D Structure
ModBase 3D Structure for Q8WWQ0
Immunogen
Partial recombinant corresponding to aa1599-1706 from human PHIP (NP_060404) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDL
Conjugate
APC

Product Categories/Family for anti-PHIP antibody

Antibodies; Signal Transduction
Applications Tested/Suitable for anti-PHIP antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-PHIP antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PHIP antibody

Western Blot detection against Immunogen (37.88kD).
Mouse Anti-PHIP Monoclonal Antibody – Cat# MBS6138219

Immunofluorescence (IF) of anti-PHIP antibody

Immunofluorescence of monoclonal antibody to PHIP on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-PHIP Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6138219

Other Notes

Small volumes of anti-PHIP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PHIP. It may not necessarily be applicable to this product.

NCBI GI #
1081684143
NCBI Accession #
NP_060404
UniProt Primary Accession #
Q8WWQ0
GenBank Nucleotide #
NM_017934
NCBI Official Full Name
PH-interacting protein
UniProt Protein Name
PH-interacting protein
UniProt Synonym Protein Names
IRS-1 PH domain-binding protein; WD repeat-containing protein 11
Protein Family
PH-interacting protein
UniProt Gene Name
PHIP
UniProt Synonym Gene Names
WDR11; PHIP
UniProt Entry Name
PHIP_HUMAN

UniProt Comments for PHIP

PHIP: Probable regulator of the insulin and insulin-like growth factor signaling pathways. Stimulates cell proliferation through regulation of cyclin transcription and has an anti- apoptotic activity through AKT1 phosphorylation and activation. Plays a role in the regulation of cell morphology and cytoskeletal organization. Interacts with IRS1 and IRS2. Interacts (via bromo domain) with acetylated lysine residues on histone H1.4, histone H3 and H4 (in vitro)

Chromosomal Location of Human Ortholog: 6q14

Cellular Component: nucleus

Molecular Function: protein binding; insulin receptor binding

Biological Process: positive regulation of insulin-like growth factor receptor signaling pathway; regulation of cell shape; regulation of protein amino acid phosphorylation; positive regulation of mitosis; protein import into nucleus; regulation of growth; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; insulin receptor signaling pathway; regulation of cell morphogenesis; cytoskeleton organization and biogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000